SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007235 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007235
Domain Number 1 Region: 9-83
Classification Level Classification E-value
Superfamily PDZ domain-like 4.73e-20
Family PDZ domain 0.000069
Further Details:      
 
Domain Number 2 Region: 316-345
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000376
Family LIM domain 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000007235
Domain Number - Region: 287-315
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0413
Family LIM domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007235   Gene: ENSMLUG00000007918   Transcript: ENSMLUT00000007923
Sequence length 356
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430095:454951:465669:1 gene:ENSMLUG00000007918 transcript:ENSMLUT00000007923 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALTVDVMGPAPWGFRITGGRDFHTPIMVTKVTERGKAQAADLRPGDIIVAINGEDAQGM
LHAEAQSKIRQSPSPLRLQLDRSRAASPGQTNGESTMEVLATRFQGSVRTHTDSQSSLRS
SCSSPASLSPQPCSPFSTQAPTSPHALAGEAVMSRSSQSLAHNPGLIAADRLSYGGHPGR
RQSGLGLAGDSAVRVLPPSPGPQPSSPRLSMDSERGSQLLREDSEVFKMLQENREGRVAP
RQSSSFKLLQEALEAEERGGTPAFLPSSLSPQSSLPTPRAPATPPKLHTCEKCSTSIANQ
AVRIQEGRYRHPGCYTCADCGLNLKMRGHFWVGDELYCEKHARQRYSAPKALTSQA
Download sequence
Identical sequences G1PAC9
ENSMLUP00000007235 XP_006100792.1.53796 ENSMLUP00000007235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]