SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007310 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007310
Domain Number 1 Region: 56-226
Classification Level Classification E-value
Superfamily vWA-like 4.77e-18
Family Integrin A (or I) domain 0.024
Further Details:      
 
Domain Number 2 Region: 321-383
Classification Level Classification E-value
Superfamily Cysteine-rich domain 3.56e-17
Family TFIIH p44 subunit cysteine-rich domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007310   Gene: ENSMLUG00000007994   Transcript: ENSMLUT00000008003
Sequence length 393
Comment pep:novel scaffold:Myoluc2.0:GL429767:41632260:41651116:-1 gene:ENSMLUG00000007994 transcript:ENSMLUT00000008003 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEEPERTKRWEGGYERTWEILKEDESGSLKATIEDILFKAKRKRVFEHHGQVRLGMMRH
LYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTEL
SGNPRKHITSLKKAVDMTCHGEPSLYNSLNMAMQTLKHMPGHTSREVLIIFSSLTTCDPS
NIYDLIKTLKTAKIRVSVIGLSAEVRVCTVLARETGGTYHVILDESHYKELLTHHVSPPP
ASSSSECSLIRMGFPQHTVASLSDQDAKPSFSMAKNLETVSDDVFIVLIPFYKLQMKKMG
LKCNGFCLTLVSAPHLARSYHHLFPLDAFQEVSLEEHNGERFCYGCQGELKDQHVYHCTV
CQNVFCVDCDVFVHDSLHCCPGCIHNIPTPSGI
Download sequence
Identical sequences G1PAJ5
ENSMLUP00000007310 ENSMLUP00000007310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]