SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007345 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007345
Domain Number 1 Region: 287-444
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-39
Family SPRY domain 0.00018
Further Details:      
 
Domain Number 2 Region: 7-78
Classification Level Classification E-value
Superfamily RING/U-box 4.01e-18
Family RING finger domain, C3HC4 0.0047
Further Details:      
 
Domain Number 3 Region: 91-151
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000931
Family B-box zinc-binding domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007345   Gene: ENSMLUG00000027910   Transcript: ENSMLUT00000008039
Sequence length 449
Comment pep:novel scaffold:Myoluc2.0:GL430655:15499:16848:1 gene:ENSMLUG00000027910 transcript:ENSMLUT00000008039 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFAASLAHLQAEASCPLCLDYLRDPVTTACGHNFCPSCIHQRWEGLRGTFPCPVCLHHC
PDRSLKRNTQLCHMTEIAQQIPTSGSQRKMQEEMPLCGKHREVLTLFCEKRLELLCPQCK
GSLDPQDQPLVPMEEAAASQRGMLKRYIGVLTEYLKNSVQVYEYQGANILAVKRKMNKWR
NDLDYECNDLKYSLEIEYNEFDNDLLVEENNVEEKLIENGRQISHRMFRLSSRLSEIEEK
CLQTDEDLLTGIESIHSSYEHRESPAIFSYKLEKGIFTLPPHYLGLRKMIRTFQADLTLD
PETAHPDLLISRNGKQATYWIPDRILNPQALTSYPAVLSSEGFDAGRHFWVVTIGVTGEC
SLGVCEESFPINTLISPSPSNGCWTHTFGPSSIPKEIGVFLDYELGEVSFYNLKTCSLLY
GITATFTGKLMPYFSIVSSEPLTTSIIRV
Download sequence
Identical sequences G1PAM3
ENSMLUP00000007345 ENSMLUP00000007345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]