SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007354 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007354
Domain Number 1 Region: 682-1042
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.87e-90
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.000000107
Further Details:      
 
Domain Number 2 Region: 483-678
Classification Level Classification E-value
Superfamily ARM repeat 1.9e-55
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.000053
Further Details:      
 
Domain Number 3 Region: 104-283
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.79e-48
Family Ras-binding domain, RBD 0.0044
Further Details:      
 
Domain Number 4 Region: 331-477
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.05e-45
Family PLC-like (P variant) 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007354   Gene: ENSMLUG00000008026   Transcript: ENSMLUT00000008049
Sequence length 1053
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430425:32889:45934:1 gene:ENSMLUG00000008026 transcript:ENSMLUT00000008049 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPGVDCPMEFWANEENQSVAVDFLLPTGVYLNFPVSRNANLSTIKKALWHRAQYEPLFH
MLSDPEAYVFTCVNQTAEQQELEDEQRKCDIQPFLPVLPLAREGDRVKKLINSQISLLIG
KGLHEFDSLRDPEENDFRVKMRQFCEEAAARRQQLGWEAWLQYSFPLQLEPSARTWGAGT
LRVPNRALLVNVKFEGSEESFTFQVSTKDVPLALMACALRKKATVFRQPLVEQPEDYTLQ
VNGKQEYLYGSYPLCQFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNPAPQVQKSRTK
PPPIPMKKSSGCWALGRLRHVFWLTVLTQGIKMIAVGRIKLVVQAGLFHGNETLCKTVSS
SEVSVCSEPVWKQRLEFDINVCDLPRMARLCFALYAVIEKAKKARSTKKKSKKADCPIAW
ANLTLFDYKDQLKTGERCLYMWPSVPDEKGELLNPTGTVCSNPNTESAAALVICLPEVAP
HPVYYPALDKILELGRHGEHGRATEEEQLQLREILERRGSGSGSGELYEHEKDLVWKMRH
EVQERFPEALARLLLVTKWNRHEDVAQMLYLLCSWPELPVLSALELLDSSFPDRHVGSFA
IKSLRKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLDRALANRKIGHFLFWHLRSEMH
VPSVALRFGLIMEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKVSSQKSPKPQTKELMH
LCMRQETYLEALSHLQSPLDPRILLAEVCVEQCTFMDSKMKPLWVMYSNEEAGGDGSVGI
IFKNGDGAGGTDLRQDMLTLQMIQLMDILWKQEGLDLRMTPYGCLSTGDRTGLIEVVLRS
DTIANIQLNKSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGI
GDRHSDNIMIRENGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSE
KFERFRGYCERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEA
LKHFRVKFNEALRESWKTKVNWLAHNVSKDNRQ
Download sequence
Identical sequences G1PAN1
ENSMLUP00000007354 ENSMLUP00000007354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]