SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007363 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007363
Domain Number 1 Region: 144-239
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00000354
Family cAMP-binding domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007363   Gene: ENSMLUG00000008070   Transcript: ENSMLUT00000008060
Sequence length 364
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429851:2594287:2612746:-1 gene:ENSMLUG00000008070 transcript:ENSMLUT00000008060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSANSSTLGQRLWQGPVCAGWKQDMEGALYHLANCVLLLGFMGGSGVYGCFYLFGFLGTG
YVCYVLWGWFNACGLDIVIWNFLLAMACLLQLAHLVYRLRKDTLPEEFDLLYKTLCVPLQ
VPMQAYKEIVRCCEEQVLTLATEQTYAVEGETPINRLSLLLSGRVRVSQDGQFLHYIFPY
QFMDSPEWESLPPSEEGVFQVTLTAETPCSYISWPRKSLHLLLAKERYISRLFSVLLGYD
ISEKLYALNEKLFAKFGLCFDIRLPSLYHVLGSAASDAGPESEKEDEEVHEPAPAPPQAM
PTPVQHMPPCSPLPAATHPPAQPSRARMSRPDSDGLASRIPLQSYSQVMSTGQAPLAPIH
TPEL
Download sequence
Identical sequences G1PAN7
XP_006090977.1.53796 ENSMLUP00000007363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]