SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007377 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007377
Domain Number 1 Region: 2-289
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 1.1e-62
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007377   Gene: ENSMLUG00000008081   Transcript: ENSMLUT00000008077
Sequence length 468
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429872:3913700:3943098:1 gene:ENSMLUG00000008081 transcript:ENSMLUT00000008077 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GEYVKPFTPEKAKEIIMSLQQPAVFCNMVFDWPAQHWTAEHLSKVLNGKQIRFRMGMKST
DTVPQFETSCSYVEATLEEFLTWNCDHSSTSGPFIDYDYSKFWAYADYKYVVSLFEDKTD
IFQDVIWSDFGFRGRNGRESTLWIGSLGAHTPCHLDSYGCNLVFQVQGRKRWHLFPPEDT
PFLYPTRIPYEESSVFSKVNVVNPDVKRFPRFQEARRHVVTLSPGQVLFVPRHWWHYVES
VDPVTVSINSWIELEEDHQARVEEAIARMLVCALKTAEDPHSTRAWLNPTEVEETSHEVN
CRYLNRAVSAFFDHYRTSKTEIQALRTNGEHMKKEEFNMHNNLMEVEQTDSQNLTSGTVG
EQAACPFGPDLVPVLPSSEDPPSETGGMFKNDGKDFVGKAGEHFDKLHCTKKQRMMSGRE
NEIVEQVASNSTMAPSQTFISTDDLLDCLVNPQVTKIVAQLLIQGRSL
Download sequence
Identical sequences G1PAP7
ENSMLUP00000007377 ENSMLUP00000007377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]