SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007470 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007470
Domain Number 1 Region: 262-363
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.43e-30
Family Ras-binding domain, RBD 0.0048
Further Details:      
 
Domain Number 2 Region: 399-511
Classification Level Classification E-value
Superfamily PH domain-like 4.11e-16
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007470   Gene: ENSMLUG00000008162   Transcript: ENSMLUT00000008182
Sequence length 691
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429770:7859215:7903698:-1 gene:ENSMLUG00000008162 transcript:ENSMLUT00000008182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQLSDEEIDHGAEEDSDKEDQDLDKMFGAWLGELDKLTQSLDSDKPMEPVKRSPLRQET
NMANFSYRFSIYNLNEALSQGETVDLDALMADLCSIERELSSIGAGNSKRQITETKASQK
LPPSRHTTKHGTLKGLSSSSNRITKPSHANYSLDDITAQLDQASLSMDEAAQQSVLEDAK
PLVTNQHRRTASAGTVSDAEVRSMSNSSRSSITSAASSMDSLDIDKVTRPQELELTHQGQ
PITEEEQAAKLKAEKIRVALEKIKEAQVKKLVIRVHMSDDSSKTMMVDERQTVRQVLDNL
MDKSHCGYSLDWSLVETISELQMGTERIFEDHENLVENLLNWTRDSQNRLMFMERIEKYA
LFKNPQNYLLGKKETAEMADRNKEVLLEECFCGSSVTIPEIEGVLWLKDDGKKSWKKRYF
LLRASGIYYVPKGKAKVSRDLVCFLQLDHVNVYYGQDYRNKYKAPTDCCLVLKHPQIQKK
SQYIKYLCCDDVRTLHQWVNGIRIAKYGKQLYMNYQEALKRTESACDWTSLSSSSIKSGS
SSSSIPESQSNHSTQSDSGVSDSQPAGHVRSQSIVSSIFSEAWKRGTQLEESSKARMDSM
NRSYTSLMPPLSPQPKLVSPYTASQPSPPLPPPPPPPPPPPPPPPPPPPPLPSQSATSGG
SAATMVVKNSTITRVAERLSAFRDPLFKAPT
Download sequence
Identical sequences G1PAX6
ENSMLUP00000007470 ENSMLUP00000007470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]