SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007485 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007485
Domain Number 1 Region: 418-625
Classification Level Classification E-value
Superfamily PUA domain-like 3.98e-78
Family SRA domain-like 0.00000000411
Further Details:      
 
Domain Number 2 Region: 9-85
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.2e-18
Family Ubiquitin-related 0.0000267
Further Details:      
 
Domain Number 3 Region: 736-791
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000141
Family RING finger domain, C3HC4 0.0095
Further Details:      
 
Domain Number 4 Region: 316-382
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000354
Family PHD domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007485   Gene: ENSMLUG00000008170   Transcript: ENSMLUT00000008199
Sequence length 817
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430379:223435:261474:1 gene:ENSMLUG00000008170 transcript:ENSMLUT00000008199 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSALAAPAGIMWIQVRTMDGKVAHSVGSLSRLTKVEELREKIQELFHVEPGRQRLFYRGK
QMEDGHTLFDYDVRLNDTIQLLVRQNLMPPPPSSSSSNNQERDSELSDTDSGYCLGQSES
DKSSTSGEVAAEADRNAGLADEAVCDETELGLYKANEYVDARDTDVGSWFEAKVVRVTKK
PPSQDAPCSSTSTLEEDDDVIYHVTYDDYPEYGVVQMSSQNVRARAREIIRWQELKEGQE
VMLNYNPDSPKERGFWYDAVITRKNQTRTSRELYANVRLGSSSLSNCRIMFVDEVFKIER
PGEGAPMVENPVKRKNKPFCDKCKDNPSKPCHECSCSLCGSKQDPDKQLMCDDCDHAFHL
YCLNPPLSSVPTETEWFCPKCRNDASEVVLAGEKLKESKKKSKMASATSSSQRDWGKGMA
CVGRTKECTIVPSNHYGPIPGIPVGTMWRFRVQVSESGVHRPHVAGIHGRSNDGAYSLVL
SGGYEDDVDNGESFTYTGSGGRDLSGNKRTAEQSCDQKLTNTNRALALNCSAPINERKGA
EAKDWRSGKPVRVVRNVKGRKHSKYAPTEGNRYDGIYKVVRYWPEKGKSGFLVWRYLLRR
DDEEPGPWTKKGKNRIKQLGLTMQYPEGYLEALAKKEKEKENRKRPTEEAEEKDEEEEEE
EDFTSPRKSKRRSKSEGRSLSSACSPRVTPKKTKVEPYSLTAQQKALIKQDQSNTKLWTE
ILKSLKDGPIHALRFQKFLNKVEETFQCICCQELVFRPITTVCQHNVCKNCLDRSFRAQV
FSCPACRRELGRNYSMKVNQPLQAILIQLFPGYGNGR
Download sequence
Identical sequences G1PAY9
ENSMLUP00000007485 ENSMLUP00000007485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]