SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007518 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007518
Domain Number 1 Region: 183-414
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 9.75e-70
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007518   Gene: ENSMLUG00000008241   Transcript: ENSMLUT00000008236
Sequence length 415
Comment pep:novel scaffold:Myoluc2.0:GL430391:182327:197607:1 gene:ENSMLUG00000008241 transcript:ENSMLUT00000008236 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TAEDSSRDALAGPGALWEALWALLPRTKEELRLDLGASVEGSVVVLLQQAADLFYGGRRS
ECLQTSEVVLDYSWEKLNTGLWQDVDKDWRRVYAFGCLLKAMCLCEAPGDSATVATALRV
CDMGLLMGAAIFDDILIKVAAVLQAHLPPGKRPAQGPAPEQPRLKKARNGHVSIPDMRSE
KAVPRLHCPSLQHFRKHYLIPQTPVILEGVADHWPCMKKWSLEYIQEIAGCRTVPVEVGS
RYTDEEWSQRLMTVSEFISCYILNEPRDVGYLAQHQLLDQIPELKQDISIPDYCCLGDGE
EEEITINAWFGPPGTVSPLHQDPQQNFLAQVLGRKYIRLYSPQESEAVYPHDTHLLHNTS
QVDVENPDLEKFPRFAEAPFLSCILSPGELLFIPVKYWHYVRALDLSFSVSFWWT
Download sequence
Identical sequences G1PB16
ENSMLUP00000007518 ENSMLUP00000007518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]