SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007524 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007524
Domain Number 1 Region: 312-665
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.15e-128
Family Mammalian PLC 0.0000000000238
Further Details:      
 
Domain Number 2 Region: 880-932,972-1148
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 1.26e-56
Family C-terminal domain of PLC-beta 0.00000179
Further Details:      
 
Domain Number 3 Region: 144-310
Classification Level Classification E-value
Superfamily EF-hand 5.71e-49
Family EF-hand modules in multidomain proteins 0.0000000509
Further Details:      
 
Domain Number 4 Region: 12-141
Classification Level Classification E-value
Superfamily PH domain-like 6.76e-43
Family Pleckstrin-homology domain (PH domain) 0.00000023
Further Details:      
 
Domain Number 5 Region: 685-801
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.38e-23
Family PLC-like (P variant) 0.00000273
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007524   Gene: ENSMLUG00000008221   Transcript: ENSMLUT00000008245
Sequence length 1182
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429876:328012:347063:-1 gene:ENSMLUG00000008221 transcript:ENSMLUT00000008245 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLLNPVLLPPQVKAYLSHGERFIKWDDETTLASPVILRVDPKGYYLYWTYQSKEMEFLD
ITSIRDTRFGKFAKIPKSQKLREVFNLDFPDNNFLLKTLTVVSGPDMVDLTFHNFVSYKE
NVGKDWAEDILALVKHPLTSNAPRTTFLDKILVKLKMQLNPEGKIPVKNFFQMFPADRKR
VEAALSACHLPKGKNDSINPEDFPQSVYKSFLMNLCPRPEIDEIFTSHHAKAKPYMTKEH
LTKFINQKQRDPRLNTLLFPPARPDQVQGLIDKYEPSGINVQRGQLSPQGMVWFLCGPEN
SVLVQDKLLVHQDMTQPLNHYFINSSHNTYLTAGQFSGLSSAEMYRQVLLAGCRCVELDC
WKGKLPDEEPIITHGFTMTTDIYFKEAIEAIAESAFKTSPYPVILSFENHVDSPRQQAKM
AEYCRAMFGDMLLTEPLEKFPLKPGSPLPSPEDLRGKILIKNKKNQFSVPASPSGEAEGS
CPPSAPVGGDTVLAGEERAEPEEEEEEEEEDVGEEEEEESGNLDEEEMKKMQSDEGTAGL
EATAYEEMSSLVNYIQPTKFTSFEFSAQKNRSYVISSFTELKAYDLLSKAAVQFVDYNKR
QMSRIYPKGTRMDSSNYMPQMFWNAGCQMVALNFQTMDLPMQQNMALFEFNGQSGYLLKH
EFMRRPDKQFNPFSVDGIDVVVATTLSIKVISGQFLSERSVRTYVEVELFGLPGDPKRRY
RTKLSPTANSINPVWNEEPFVFEKILMPELASLRVAVMEEGSKFLGHRIIPINALNTGYH
HLCLRSESNMPLTMPALFVLLEMKDYVPDTWADLTVALANPIKFFNAHDKKSVKLKEAMG
GLPEKPFSPGSPLASQVNGAPASTSNGSAGSRAAGRLTRFPAEPRTASLEELRELKGVAK
LQRRHEELRELNRPAPRRWRACSGRGATWPEFGPPGAGRTQGSGLAFFAASAGTRTGEGA
GRVRTHPEGPEGADPRVRKLRDRLELELRQQREEQCECVLKRKGAALGRHIAKMMELARE
KQAAELKTLKETSESDTKEMKKKLEAKRLERIQAMVKVTADKMAQERLKKEINNSHIQEV
VQVINQMTESLERHQEKLEEKQAACLEQIRELEKQLQQEVLAEYEARMKGLETEVKESVR
TCLRTYFPAEAEDKPERSCEASRELCEQDSLTVNADTQESCL
Download sequence
Identical sequences G1PB22
ENSMLUP00000007524 ENSMLUP00000007524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]