SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007555 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007555
Domain Number 1 Region: 989-1117
Classification Level Classification E-value
Superfamily PH domain-like 3.41e-22
Family Pleckstrin-homology domain (PH domain) 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007555   Gene: ENSMLUG00000008263   Transcript: ENSMLUT00000008279
Sequence length 1134
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429785:2171227:2201450:-1 gene:ENSMLUG00000008263 transcript:ENSMLUT00000008279 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKTMTTKLLERTRARRENLQRKMAERPTAAPRSVPPAKRAREPLAEASNQQPLSGGQEKS
CTKPSPSKKRCSDNTEEEVSNLENAQPVESASAKPCSPSPVSPQAQPRAPAPASDSPPAT
QASLLGLQRAPNARPEASAASSVKTRMQKLAAQRRHWDNDEVTDDTPESSLIPAMPAEDK
AASPPKPAEALATPVGRRGRLANLAAIICSWEDDVSLSSAKQNSAPGQPGTTCLSKASSA
SGASAGINGRSVAQEAACCSPRGGHASLSKAPASRAAAASLPTGAVSSAAKKAASSPVKA
SISVTNAKNCEVRKPERLQKTPASPLKTEVSKPIGKSAESQTVRPKEEVNRETCLQSHSK
DKSTTPVGAGVKPFLERFGERCLERSKDSPTRSTPHRTPVVTPNTKAIQERLLKQNTSSS
TTHVAQRLKQEREKELACLRGRFDKGNLWSAEKGENSRSKQLETKQEIHSQNTPLRKHQV
VSNTQSGPVTEKEKAAGEQTPAQPPSPEPAGFTECEMTKSSPLKITLFLEEEKSLKVTSD
PKVEQQTEVERDIEMSVDDEDDINSSRVINDIFSAVLQEGELGVARSPEQRGQAGAESGE
DQEDALNISSMSLLAPLAQTVGVISPESFASSPRLELKGSSIHDESPKPGKFQRTRVPRA
ESGDSLGSEDRDLPYSIDAYRSQRIKETDRPSIKQIARKEDATSKLEGKRNAEEKSVFPC
QVNVKQKMQELNNEINLQQTVIYQASQALNCCVDEEHGKGSLEEAEAERLLLIATEKRTL
LIDELNKLKSEGPQRKNKAGLLSQSEFVPSKGSVTLSEIRLPLKADFVCSTAQKPDAATY
SFLIILKAGAENMVATPLASTTTSLNGDALTFSTTYTLEDVSNDFEISIEVYSLVQKKDP
SVPDKKKKAYKSKAITPKRLLTSITTKSSLHSSVMASPGGLHAVRTSNFILVGSYTLSLS
SVGNTKFALDKVPFLSPLEGHIYLKIKCQVNSSVEEKGFLTIFEDVSGFGAWHRRWCILS
GNCISYWTYPDDEKRKNPIGRINLANCTSRQIEPANREFCARRNTFELITVRPQREDDRE
TLVSQCRDTLCVTKHWLSADTKEERDLWMQKLNQVLVDIRLWQPDACYKPLGKP
Download sequence
Identical sequences G1PB45
ENSMLUP00000007555 ENSMLUP00000007555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]