SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007577 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007577
Domain Number 1 Region: 60-174
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.91e-27
Family Ankyrin repeat 0.0012
Further Details:      
 
Domain Number 2 Region: 3-62
Classification Level Classification E-value
Superfamily SH3-domain 5.64e-21
Family SH3-domain 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007577   Gene: ENSMLUG00000008299   Transcript: ENSMLUT00000008301
Sequence length 205
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429798:4111033:4137322:1 gene:ENSMLUG00000008299 transcript:ENSMLUT00000008301 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GQVKVFRALYTFEPRTPDELYFEEGDIIYITDMSDTSWWKGTSKGRTGLIPSNYVAEQAE
SIDNPLHEAAKRGNLSWLRECLDNRVGVNGLDKAGSTALYWACHGGHKDIVEMLFTQPNI
ELDQQNKLGDTALHAAAWKGYADIVELLLAKGKGARTDLRNNEKKLALDMATNAACATLL
KKKQGTDAVRTLSNAEDYLDEDDSD
Download sequence
Identical sequences G1PB66
ENSMLUP00000007577 ENSMLUP00000007577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]