SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007613 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007613
Domain Number 1 Region: 366-551
Classification Level Classification E-value
Superfamily NTF2-like 1.07e-58
Family NTF2-like 0.000000879
Further Details:      
 
Domain Number 2 Region: 102-196
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.23e-34
Family Non-canonical RBD domain 0.000099
Further Details:      
 
Domain Number 3 Region: 549-613
Classification Level Classification E-value
Superfamily UBA-like 6.63e-17
Family TAP-C domain-like 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007613   Gene: ENSMLUG00000008341   Transcript: ENSMLUT00000008341
Sequence length 616
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429769:32601360:32607879:-1 gene:ENSMLUG00000008341 transcript:ENSMLUT00000008341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TIDVLFSISGHNPEGDTTERRPRRWGIYRRRYNNVSEQVSSGIHPSSHRQQDGDSATSDA
HMDTRVRYAPYAIPHCHWRGNFQERVQTHINKEREQNPPETKMEEKKQDETSGNWFKITI
PFGIKYDEKWLLNLIQKQCSVPFTPVEFHYEKMQAHFFVENASIAFALKNVGGKICDKNN
EKISIFVIPSNAPQTVQKELKSEKEDQIKVMQTPDQVKSAEELDQGKGLEPEDMSAKRNP
ICTTLPDNSTNVRLVVPSFTPDSAPKLIQHALLRLYSRKHDIPSSPVLGVTSLESDAGHW
RRESGHLDGSYLAEWRSGGLLASTRQGCSADSSSYILELFPKLLCLDGQEPPPPTNLGIE
AHKNVPSCKGSFFGSDPLKSLVLQFLKQYYSIYDSGDRHCLLCTYHDKACFSLTIPFNPN
DPAQSTLFEYFKDNRNMKNRKDPNLHFQLLKHTKRDITCTLCVLPKTQHDLSSFVVDMLF
QSERMLCFCVNGVFKEVEVEGRSQGSVRAFTRTFITTPASDSSLCIMNDELFVRDATPNT
TQSVHSIEVPTPTTSSMTTLSQEQQEMVQVFSTKSGMSLQLSQKCLHDNHWDYTRAVQVL
ALCKAKYKLSEEALPQ
Download sequence
Identical sequences G1PB99
ENSMLUP00000007613 ENSMLUP00000007613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]