SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007615 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007615
Domain Number 1 Region: 1-82
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.58e-25
Family Ras-binding domain, RBD 0.0074
Further Details:      
 
Domain Number 2 Region: 892-1015
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.03e-24
Family Ankyrin repeat 0.000000728
Further Details:      
 
Domain Number 3 Region: 1020-1084
Classification Level Classification E-value
Superfamily SH3-domain 1.31e-18
Family SH3-domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007615   Gene: ENSMLUG00000008333   Transcript: ENSMLUT00000008343
Sequence length 1091
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430563:32753:73647:1 gene:ENSMLUG00000008333 transcript:ENSMLUT00000008343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILTVFLSNNEQILTEVPVTPETTCRDVVEFCKEPGEGSCHLAEVWRGNERPIPFDHMMY
EHLQKWGPRREEVKFFLRHEDSPTESSEQGGRGARRCRLQAEVMLAPGGRSTAKGVGHPR
VELTLSELQDMAARQQQQIENQQQMLVAKEQRLHFLKQQERHQQQSISENEKLQKLKERV
EAQENKLKKIRAMRGQVDYSKIMNGNLSAEIERFSAMFQEKKQEVQTAILRVDQLSQQLE
DLKKGKLNGLQPYTGKLTGPAAVELKRLYQELQIRNQLNQEQNSKLQQQKDLLNKRNMEV
AMMDKRIGELRERLYGKKIQAPLSRVNGASSPQSPLSTPGRVAAVGPYIQVPSAGSCSAP
GDPIKPQSLTVASGAAHGRPKPANDGNWPTLKQNMSSAVKPTQMAPVDWKDPSVEGPLRQ
GPVSSQPAPLSALGAPEKLGIEMGKMPPPVPGVGKQLPPSYGTHPSPAPVGPGPTNSLER
RKEGSLPRPSAGLAGRQKPGPLPSVGSTHPPGSSQQIQQRISVPPSPTYPPAGPPAFPTG
DGKPELPLTVAIRPFLADKGSRPQSPRKGPQTVNSSSIYSMYLQQATPPKNYQPAVHGAS
NKSVKAVYGKPVLPSGSGSTSPSPLPFLHGPLATSTSQPTPPAESAEREPEQDSPAPPAE
ATGAMESLPRPLSPTKLTPIVHSPLRYQSDADLEALRRKLANAPRPLKKRSSITEPEGPG
GPNIQKLLYQRFNTLAGGMEGTPFYQPSPSQGLTGTLADMDNGNTNANGNLGEASPAQPT
APLPAEPAPASDANHNELPSPEPEGLLRLQTTPQAVEPAEDNNNNVAMALSTEQVPSPGP
EAPSPGEEPVSPSRPPVAPLLAASTSKRTNLKKPNSERTGRGLRVRFNPLALLLDASLEG
EFDLVQRIIYEVEDPSKPNDEGITPLHNAVCAGHHHIVRFLLDFGVNVNAADSDGWTPLH
CAASCNSVHLCKQLVESGAAIFASTISDIETAADKCEEMEEGYIQCSQFLYGVQEKLGVM
NKGVVYALWSYEAQNSDELSFREGDAITILRRKDEHETQWWWARLGDREGYVPRNLLGLC
PRIQPRQRTLA
Download sequence
Identical sequences G1PBA1
ENSMLUP00000007615 ENSMLUP00000007615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]