SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007621 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007621
Domain Number 1 Region: 252-520
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.7e-74
Family Protein kinases, catalytic subunit 0.000000000405
Further Details:      
 
Domain Number 2 Region: 116-243
Classification Level Classification E-value
Superfamily SH2 domain 2.56e-38
Family SH2 domain 0.00000318
Further Details:      
 
Domain Number 3 Region: 71-137
Classification Level Classification E-value
Superfamily SH3-domain 8.51e-17
Family SH3-domain 0.0000488
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007621   Gene: ENSMLUG00000008355   Transcript: ENSMLUT00000008353
Sequence length 528
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429827:2502731:2526602:1 gene:ENSMLUG00000008355 transcript:ENSMLUT00000008353 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WNPASKTPLPGLRASRAHLPSLCRRMGCVKSKFLRDRDKVSKSEASANPHSPLYVPDPTS
TGKRRPDPNNGNPPGPRRGSKDNIVIALYDYEAIHHEDLSFQKGDQMAVLEESGEWWKAR
SLATRKEGYIPSNYVARVDSLETEEWFFKGISRKDAERQLLAPGNVLGSFMIRDSETTKG
SYSLSVRDYDPQHRDAVKHYKIRTLDNGGFYISPRNTFSTLQELVAHYMKGSDGLCQKLT
VPCVSSKPQKPWEKDAWEIPRESLELEKKLGAGQFGEVWMATYNKHTKVAVKTMKPGSMS
VEAFLAEANLMKTLQHDKLVKLHAVVTEEPIYIITEFMAKGNYLFFLKKTSGSTGVLPDL
APIQVEISEGMAFIEQRNYIHRDLRAANILVSATLVCKIADFGLARVIEDNEYTAREGAK
FPIKWTAPEAINFGSFTIKSDVWSFGILLMEIVTYGRIPYPGMTNPEVIRALERGYRMPR
PEHCPEELYNIMTRCWKNRPEERPTFEYIQSVLDDFYTATESQYQQQP
Download sequence
Identical sequences G1PBA7
ENSMLUP00000007621 ENSMLUP00000007621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]