SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007648 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007648
Domain Number 1 Region: 103-218
Classification Level Classification E-value
Superfamily PDZ domain-like 1.71e-19
Family PDZ domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007648   Gene: ENSMLUG00000008387   Transcript: ENSMLUT00000008381
Sequence length 333
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430077:958985:961884:-1 gene:ENSMLUG00000008387 transcript:ENSMLUT00000008381 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLGLGRRKKAPPLVENEEAEPGRGGLGVEDPGPLGGGGVGGPQMGLPPPPPALRPRLVF
HTQLAHGSPTGRIEGFTNVKELYGKIAEAFRLPAAEVMFCTLNTHKVDMDKLLGGQIGLE
DFIFAHVKGQRKEVEVFKSEEALGLTITDNGAGYAFIKRIKEGSVIDHIQLISVGDMIEA
INGQSLLGCRHYEVARLLKELPRGRTFTLKLTEPRKAFDMISMRSGGGRPGSGPQLGTGR
GTLRLRSRGPATVEDLPSAFEEKAIEKVDDLLESYMGIRDTELAATMVELGKDKRNPDEL
AEALDERLGDFAFPDEFVFDVWGAIGDAKVGRY
Download sequence
Identical sequences G1PBC9
ENSMLUP00000007648 XP_006100397.1.53796 XP_014321245.1.53796 XP_014321246.1.53796 XP_014321247.1.53796 ENSMLUP00000007648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]