SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007665 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007665
Domain Number 1 Region: 409-598
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.06e-48
Family cAMP-binding domain 0.00011
Further Details:      
 
Domain Number 2 Region: 162-407
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.1e-39
Family Voltage-gated potassium channels 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007665   Gene: ENSMLUG00000008401   Transcript: ENSMLUT00000008399
Sequence length 693
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430116:429311:440816:-1 gene:ENSMLUG00000008401 transcript:ENSMLUT00000008399 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IKLTMKKNIINTQHSFINIPNVIVPDMEKKIRRMENGACSSFSDDDDDSASIFEDSESEN
PCARDSFRNSSRRKGGLSQREQYLPGVIALFNVNNSSNKEQEPKEKKKKKKEKKSKPDDK
NENKKDLEKKKKKEKDKEKKKKEGKKDKDKKEEEKKEVMVIDPSGNTYYNWLFCITLPVM
YNWTLIIARACFEELQSDYLAYWLVFDYLSDTVYLLDMIVRTRTGYLEQGLLVKEELKLI
EKYKSNLQFKLDVLSVVPTDLLYFKLGWNYPEIRLNRLLRISRMFEFFQRTETRTNYPNI
FRISNLVMYIVIIIHWNACVYYSISKAIGFGNDTWVYPDVNDPEFGRLARKYVYSLYWST
LTLTTIGETPPPVRDSEYVFVVVDFLIGVLIFATIVGNIGSMISNMNAARAEFQARIDAI
KQYMHFRNVSKDMEKRVIKWFDYLWTNKKTVDEREVLKYLPDKLRAEIAISVHLDTLKKV
RIFADCEAGLLVELVLKLQPQVYSPGDYICKKGDIGREMYIIKEGKLAVVADDGITQFVV
LSDGSYFGEISILNIKGSKAGNRRTANIKSIGYSDLFCLSKDDLMEALTEYPDAKGMLEE
KGKQILMKDGLLDVNIANAGHDPKDLEEKVTRMEGSVDLLQTRFARILAEYESMQQKLKQ
RLTKVEKFLKPLIETEFSAIDGSGVGSGPTDSA
Download sequence
Identical sequences G1PBE3
ENSMLUP00000007665 ENSMLUP00000007665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]