SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007686 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007686
Domain Number 1 Region: 114-128,179-419
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.7e-65
Family Nuclear receptor ligand-binding domain 0.0000231
Further Details:      
 
Domain Number 2 Region: 45-128
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.22e-28
Family Nuclear receptor 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007686   Gene: ENSMLUG00000008408   Transcript: ENSMLUT00000008422
Sequence length 419
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429808:2464663:2470737:1 gene:ENSMLUG00000008408 transcript:ENSMLUT00000008422 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRTWTAAPSSFHVAAAAPTAVAASRKESPGRWGPGEEQTGVGPSLQCRVCGDSSSGKHYG
IYACNGCSGFFKRSVRRKLIYRCQVGAGMCPVDKAHRNQCQACRLKKCLQEGMNQDAVQN
ERQPRSAAQIRLDRAESGREARPEPLVASLAPTGPNPRGPTPASAARALGPVAITPPGHH
QFMASLITAETCAKLEPEDADENIDVTSNDPEFPSSPHSSSSPCGVDSIHETSARLLFMA
VKWAKSLPVFSNLPFRDQVILLEEAWSELFLLGAIQWSLPLDSCPLLAPPEASAAGSSQG
RLALASAEMRFLQETVSRFRVLAVDPTEFACMKALVLFKPETRGLKDPEHVEALQDQSQV
MLSQHSKAHHPSQPVRFGKLLLLLPSLRFITSERIELLFFRKTIGNTPMEKLLCDMFKN
Download sequence
Identical sequences G1PBF9
ENSMLUP00000007686 ENSMLUP00000007686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]