SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007700 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007700
Domain Number 1 Region: 3-303
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.42e-89
Family G proteins 0.000000000245
Further Details:      
 
Domain Number 2 Region: 520-626
Classification Level Classification E-value
Superfamily PH domain-like 4.38e-26
Family Pleckstrin-homology domain (PH domain) 0.00000458
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007700   Gene: ENSMLUG00000008402   Transcript: ENSMLUT00000008438
Sequence length 871
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430486:28941:112505:-1 gene:ENSMLUG00000008402 transcript:ENSMLUT00000008438 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNRGMEELIPLVNKLQDAFSSIGQSCHLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRG
SGIVTRRPLILQLIFSKTEYAEFLHCKSKKFTDFDEVRQEIEAETDRVTGTNKGISPVPI
NLRVYSPHVLNLTLIDLPGITKVPVGDQPPDIEYQIKDMILQFISRESSLILAVTPANMD
LANSDALKMAKEVDPQGLRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQK
DIEGKKDIRAALAAERKFFLSHPAYRHMADRMGTPHLQKTLNQQLTNHIRESLPTLRSKL
QSQLLSLEKEVEEYKNFRPDDPTRKTKALLQMVQQFGVDFEKRIEGSGDQVDTLELSGGA
RINRIFHERFPFELVKMEFDEKDLRREISYAIKNIHGVRTGLFTPDLAFEAIVKKQVVKL
KEPCLKCVDLVIQELINTVRQCTSKLSSYPRLREETERIVTTYIREREGRTKDQILLLID
IEQSYINTNHEDFIGFANAQQRSTQLNKKRAIPNQGEILVIRKGWLTINNISLMKGGSKE
YWFVLTAESLSWYKDEEEKEKKYMLPLDNLKIRDVEKGFMSNKHVFAIFNTEQRNVYKDL
RQIELACESQEEVDSWKASFLRAGVYPEKDQAENEEGGVQENTFSMDPQLERQVETIRNL
VDSYVAIINKSIRDLMPKTIMHLMINNTKAFIHHELLAYLYSSADQTSLMEESAEQAQRR
DDMLRMYHALKEALNIIGDISTSTVSTPVPPPVDDTWLQSTSNHSPIPQRRPVSSVHPPG
RPPAVRGPTPGPPLMPVPVGPAASFSAPPIPSRPIPQSVFANNDPFMAPPQIPSRPARIP
PGIPPGVPSRRPPAAPSRPTIIRPAEPSLLD
Download sequence
Identical sequences G1PBG9
XP_006105787.1.53796 ENSMLUP00000007700 ENSMLUP00000007700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]