SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007761 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007761
Domain Number 1 Region: 231-351
Classification Level Classification E-value
Superfamily TIMP-like 5.65e-35
Family Netrin-like domain (NTR/C345C module) 0.00032
Further Details:      
 
Domain Number 2 Region: 90-203
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-33
Family Spermadhesin, CUB domain 0.00024
Further Details:      
 
Domain Number 3 Region: 1-79
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.1e-20
Family Spermadhesin, CUB domain 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007761   Gene: ENSMLUG00000008514   Transcript: ENSMLUT00000008512
Sequence length 351
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429788:9943183:10025123:-1 gene:ENSMLUG00000008514 transcript:ENSMLUT00000008512 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPKGKVVVLNFRFIDLESDNLCRYDFVDVYNGHGNGQRIGRFCGTFRPGALVSSGNKMMV
QMISDANTAGNGFMAMFSAAEPNERGDQYCGGRLERPSGSFKTPNWPDRDYPAGVTCLWH
ILAPKNQLIELKFEKFDVERDNYCRYDYVAVFNGGEVNDAKRIGKYCGDSPPVPIVSERN
ELLIQFFSDLSLTADGFIGHYKFRPKKLPTTTALPVTTTVTVTTGLKPTMAMCQQKCRWA
GTLESNYCSSNFVFAGTVITTITRGGSLHATISLISIYKEGNLAIQQAGKNMSAKVIVIC
KQCPLLRRGQNYIIMGQVGEDGRGKIMPNSFVMMLKTKNQKFLNALENKQC
Download sequence
Identical sequences G1PBL5
ENSMLUP00000007761 ENSMLUP00000007761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]