SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007800 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007800
Domain Number 1 Region: 158-422,513-631
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.53e-59
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0029
Further Details:      
 
Domain Number 2 Region: 2-57
Classification Level Classification E-value
Superfamily UBA-like 1.02e-22
Family UBA domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007800   Gene: ENSMLUG00000008539   Transcript: ENSMLUT00000008555
Sequence length 1061
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429884:3115801:3162139:-1 gene:ENSMLUG00000008539 transcript:ENSMLUT00000008555 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SCQMLLNQLREITGIQDPSFLQEALKASNGDITLAVNLLTDERVKEPSQDTVATEPSEVE
RSAANKEVLAKVIDLTHENKDDLQAAIALSLLESPKVQTDGRDLNRLTQITLSALKLERL
RRLRIWSQCLEPKSWKRLRGGEQSKSETGRQYFLAAVILKSLFQLPAFRRLVLSYSLPQS
VLENCPSHTEKRNIMFMQELQYLFALMMGSNRKFVDPSAALDLLKGAFRSPEEQQQDVSE
FTHKLLDWLEDAFQLAVNGSNPKKKSENPMVQLFYGTFLTEGVREGKPFCNNETFGQYPL
QVNGYHNLDECLEGAMVEGDIELLPSDHSVKYGQECWFTKLPPVLTFELSRFEFNQSLGQ
PEKIHNKLEFPQIIYMDRYMYRSKELIRSKRESIRKLKEEVKVLQQKLERYVKYGSGPAR
FPLPDMLKYVIEFASTKPASESSTSQSDTSMTSPLSPVHCPVSDLTSKESTSKESSSQDV
ESTFSGDCLHKSTTVTTPLASSRSPVSMPAHPAPRAVTEEEINFVKTCLQRWRSEIEQDI
QDLKNCIASTTQTIEQMYCDPLLRQVPYRLHAVLVHEGQANAGHYWAYIYNQPRQVWLKY
NDISVTESSWEELERDSYGGLRNVSAYCLMYINDKLPHFNAEAVPNESDQMLGELEALSV
ELKHYVQEDNWRFEQEVEEWEEEQSCKIPQMESINSTSQDFSTPPEPSGAPAHGVRCLSS
EHAVIVKEQTAQAIANTAHAYEKSGVEAALSEVMLSPAMQGVILAIAKARQTFDRDGSEA
GLIKAFHEEYSRLYQLAKEAPSSHSDPRLQHVLVYFFQNEAPKRVVERTLLEQFADKNLS
YDERSISIMKVAQAKLKEIGPDDMNMEEYKRWHEDYSLFRKVSVYLLTGLELYQKEKYQE
ALSYLVYAYQSNATLLTKGPRRGVKESVIALYRRKCLLELNAKAASLFETNDDHSVTEGI
NMMNELIIPCIHLIINNDISKDDLDAIEVMRKHWCSYLGQDIAENLQLCLGEFLPRLLDP
SAEIIVLKEPPTIRPNSPYDLCSRFAAVMESIQGVSAVTVK
Download sequence
Identical sequences G1PBQ0
ENSMLUP00000007800 ENSMLUP00000007800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]