SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007867 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007867
Domain Number 1 Region: 54-148,213-313
Classification Level Classification E-value
Superfamily PH domain-like 2.11e-42
Family Pleckstrin-homology domain (PH domain) 0.0046
Further Details:      
 
Domain Number 2 Region: 3-75
Classification Level Classification E-value
Superfamily EF-hand 0.0000173
Family Calbindin D9K 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007867   Gene: ENSMLUG00000008624   Transcript: ENSMLUT00000008632
Sequence length 631
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430114:98800:124687:1 gene:ENSMLUG00000008624 transcript:ENSMLUT00000008632 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALRKELLKSIWYAFTALDVEKSGKVSKSQLKVLSHNLYTVLHIPHDPVALEEHFRDDDD
GPVSSQGYMPYLNKYILDKVEEGAFVKEHFDELCWTLTAKKNYRAGSNGNSMLSNQDAFR
LWCLFNFLSEDKYPLIMVPDEVEYLLKKVLSSMSLEVSLAELEELLAQEAQAAQTTGGLS
VWQFLELFNSGRCLRGVGRDTLSMAIHEVYQELIQDVLKQGYLWKRGHLRRNWAERWFQL
QPSCLCYFGSEECKEKRGTIPLDGQCCVEVLPDREGKRCMFCVKTASRTYEMSASDTRQR
QEWTAAIQMAIRLQAEGKTSLHKDLKQKRREQREQRERRRAAKEEELLRLQQLQEEKERK
LQELELLQEAQRQAERLLQEEEARRRSQHQELQQALEGQLREAEQARASMQAEMELKEEE
AARQRQRIEELEDMQQRLQEALQLEVKARRDEEAVRLAQTRLLEEEEEKLKRLMRMKEDQ
ERYIEQAQQEKQELQQEMAMQSRSLQLAQQQLEEVRQNRQRADEDVEAAKRKLRQASTNV
RHWNVQMNRLMHPIEPGDKRPTTSSSFTGFQPPLLARRDSSLKRLTRWGSQGSRTTSPST
SEQQKSLNGGDEAPISASGPQEDKLDPEPEN
Download sequence
Identical sequences G1PBV6
XP_006101303.1.53796 XP_014322073.1.53796 ENSMLUP00000007867 ENSMLUP00000007867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]