SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007906 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007906
Domain Number 1 Region: 67-329
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 1.37e-39
Family PhyH-like 0.065
Further Details:      
 
Domain Number 2 Region: 943-999
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 7.82e-21
Family Tudor domain 0.00029
Further Details:      
 
Domain Number 3 Region: 1000-1055
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000000000000291
Family Tudor domain 0.00026
Further Details:      
 
Domain Number 4 Region: 777-816
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000532
Family PHD domain 0.024
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000007906
Domain Number - Region: 868-910
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0124
Family PHD domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007906   Gene: ENSMLUG00000008651   Transcript: ENSMLUT00000008674
Sequence length 1120
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430379:304071:397571:1 gene:ENSMLUG00000008651 transcript:ENSMLUT00000008674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSEDHGAQNPSCKIMTFRPTMEEFKDFNKYVAYIESQGAHRAGLAKIIPPKEWKPRQTY
DDIDDVVIPAPIQQVVTGQSGLFTQYNIQKKAMTVGEYRRLANSEKYCTPRHQDFDDLER
KYWKNLTFVSPIYGADISGSLYDDDVAQWNIGNLRTILDMVERECGTIIEGVNTPYLYFG
MWKTTFAWHTEDMDLYSINYLHFGEPKSWYAIPPEHGKRLERLAIGFFPGSSQGCDAFLR
HKMTLISPIILKKYGIPFSRITQEAGEFMITFPYGYHAGFNHGFNCAESTNFATLRWIDY
GKVATQCTCRKDMVKISMDVFVRILQPERYELWKQGKDFTVLDHTRPTALSSPELSTWST
SRASLKAKLLRRQISLKESRHWKKTEEERKPNLERKKEQSKKPGLSSHRKRSQPKKPKPE
DPKLPGEGAAGAAPPEETSGSAKEEAAQEADPEDEEEDPQLPPQGREAEGTEEDRRGKLR
PAKAKGDRKKKSPLHPHHPLLPELPPPLPPQFPCEEMPPPPLEPPVLTPGPEVTEESSLP
PPLNVMPPEAPGEELEPKPRPIIPMLYVVPWASQATCEKGRVSCQQASEHFPQKGPAWKE
QLAPMELTEPEEDSGASEVQAQSTFSKLKMEIKKSRRHPLGKPPTRSPLSVVKQEASSDE
EAFPFSGEEDMSDPEALRSLLSLQWKNKAASFQAERKFNAVAALTEPYCAICTLFYPYSQ
SLQMEKEASQASLGEGPSIPPSKCGQKTRPLIPEMCFTSSAENTEPLPANSYIGDDGTSL
LIACAKCCLQVHASCYGIRPELVNEGWTCSRCTAHAWTAECCLCNLRGGALQMTTDKRWV
HVICAIAVPEVRFLNVMERHPVDISAIPEQRWKLKCVYCRKRMKKVSGACIQCSCEHCST
SFHVTCAHAAGVLMEPDDWPYVVSITCFKHKSGGHAVQFLRAVSLGQVVITKNRNGLYYR
CRVIGSTTQTFYEVNFDDGSYSDNLYPESITSRDCVRLGPPPEGEFVELRWTDGNIYKAK
FISSVTSHIYQVEFEDGSQLTVKRGDIFTLDEELPKRVRSRLSVSTGAPQESAFPGEEVK
AAKRPRVGTPRASEDSGRNPDYLAFMESLLQAQCRPRAPF
Download sequence
Identical sequences G1PBY8
XP_014302577.1.53796 XP_014302578.1.53796 ENSMLUP00000007906 ENSMLUP00000007906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]