SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007922 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007922
Domain Number 1 Region: 1428-1502
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000998
Family SH3-domain 0.0025
Further Details:      
 
Domain Number 2 Region: 993-1167
Classification Level Classification E-value
Superfamily RUN domain-like 0.0000000745
Family RUN domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007922   Gene: ENSMLUG00000008682   Transcript: ENSMLUT00000008692
Sequence length 1512
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430191:798634:810895:-1 gene:ENSMLUG00000008682 transcript:ENSMLUT00000008692 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLFELSRMDSPPKLTGETLIVHHIPLVHCQVPDRQCCGGASGGSGSTRPNPFCPPELGI
TQPEQDLGQADSLLYNSLHSAPGGSARSADSSTKSRGRDGRGPGASKRHNPFLLQGSVAE
PGLGDLYDDSIGDSATQQSFHLHGAGQPAFHLSSFQLPPPGPRAGRPWGATQSRAGVVEG
QEQEPVTTLDPQQCSRNHCCQPELETETMELDECGGPGGSGSGGGASDTSGFSFDQEWKL
SSDESPRNPGCSGSGPQHCRCSSTSSQSEAADQSMGYVSDSSCNSSDGVLVTFSTLYNKT
HGNSHANLNSAPQSCSDSSFCSHSDPGAFYLDLQPSPAESKMSYESHHPDSGEREGSYGC
PHASSPELDANCNSYRPHCEPCPAVADLTACFQSQARLVVATQNYYKLVTCDLSSQSSPS
PAGSSITSCSEEHTKISPVPSSAPDPGPNQPSEYYLFQKPEAQPEEQVRPMEAEAPTGPT
VIEGQVYTNTSPPNLGTGRQRSRSYDRSLERSPPVRLGSLERMLSCPVRLSEGPTALAGS
SSPPKRVTSFAELAKGRKKAAGSGSPPLRVSVGDSSQDFSPIQEAQQDRAGSLDEGTHCS
HSLPPMPMGPGMDLVGSEPWSTQVYQGPQSSEMSPAVLRASGQGSLMQLMDPGSALPGSP
ANSHTQRDARARADGGGAESRPVLRYSKEQRPTTLPIQPFVFQHHFPKQLAKARALHSLS
QLYSLSGCSRAQQPAPLAPPTAQVPASDPSGEPQASTNRGARKAGPEPETSRPSPLGSYS
PIRSAGPFGLSTDSSASASCSPPPEQATATESSPPWSLSCPAVQPATSQQPQKEDQKILT
LAEYRLHGTGSLPPLGSWRSSLSRAESLARGGGEGCMASRPNNANHLSPQALKWREYRRK
NPLGPPGLSGSLDRRPQEARLTRRNPIFEFPGSLSAAGHLNCRLNGPMVKPLSLTCPDFQ
DPFSLTEKPPAEFCLSPDGNSEAISIDLLQKKGLVKAVNTAVDLIVAHFGTSRDPGVKAK
LGNSSVSPNVGHLVLKYLCPAVRAVLEDGLKAFVLDVIIGQRKNMPWSVVEASTQLGPST
KVLHGLYNKVSQFPELTSHTMRFDAFVLGLLNIRSLEFWFNHLYNHEDIIQTHYQPWGFL
SAAHTVCPGLFEELLLLLQPLALLPFSLDLLFQHRLLQSGQQQRQHKELLRVSQDLLLSA
HSTLQLARARSQEGPGDMDSAAHGKRVKGVGAPEGGEDEEEEETEEVTEAAGGSERGRAR
SGQSGWWYQLMQSSQVYIDGSTEGSRFPRGGSNSCSGGSSEKKKGAGGGGPPPREGVVEG
AEACPAPEETLGRDRGWPFWMGSPPDSVLAELRHSREREGSAAPPAESEEGASGPSSGGI
KWGHLFGSRKAQREIRPTNRLPSDWLSLDKSMFQLVAQTVGARREPEPKESQQEPHAPAL
PSKPPCEVKALCHHLATGPGQLSFHKGDVLRVLGPAGGDWLRCSRGPDTGLVPLAYVTLT
PTPSPTPGNSQN
Download sequence
Identical sequences G1PC02
XP_006102779.1.53796 XP_014323526.1.53796 ENSMLUP00000007922 ENSMLUP00000007922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]