SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007942 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007942
Domain Number 1 Region: 484-781
Classification Level Classification E-value
Superfamily L domain-like 8.84e-43
Family Internalin LRR domain 0.05
Further Details:      
 
Domain Number 2 Region: 249-543
Classification Level Classification E-value
Superfamily L domain-like 6.46e-42
Family Internalin LRR domain 0.012
Further Details:      
 
Domain Number 3 Region: 784-1038
Classification Level Classification E-value
Superfamily PP2C-like 2.88e-38
Family PP2C-like 0.0038
Further Details:      
 
Domain Number 4 Region: 144-243
Classification Level Classification E-value
Superfamily PH domain-like 0.000000493
Family Pleckstrin-homology domain (PH domain) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007942   Gene: ENSMLUG00000008702   Transcript: ENSMLUT00000008716
Sequence length 1325
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429855:3026020:3095867:1 gene:ENSMLUG00000008702 transcript:ENSMLUT00000008716 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRNGSRNCLNRRSRFGSRERDWLREDVKRGCVYLYGADTTTATTTATSSASSSSASSSS
SDLHLVLCTVETPASEICAGEGRESLYLQLHGDLVRRLEPTERPLQIVYDYLSRLGYDDP
VRIQEEAANPDLGCMLRFYGEKPCQMDQLDRILLSGIYNVRKGKTQLHKWAERLVVLCGT
CLIVSSVKDCQTGKMHILPLVGGKVEEVKRRQYSLAFSSAGAQAQTYHVSFETLAEYQRW
QRQASKVVSQRISTVDLSCYSLEEVPEHLFYSQDITYLNLRHNFMQLERPGGLDTLYKFS
HLKGLNLSHNKLGLFPVLLCEISTLTELNLSCNGFHDLPSQIGNLLNLQTLCLDGNFLTT
LPEELGNLQQLSSLGISFNNFSHIPEVYERLTMLDKVVMAGNQLEVLNLGVLSRMSHIKH
VDLRILRMNHLKTVVIENLEGNKYITHMDLRDNQLTDLDLSSFCSLEQLHCERNQLRELT
LSGFSLRTLYANSNRLTAVNVYPVPSLLTSLELSRNQLECVPDWACEAKKIEVLDVSYNL
LTEGPMRILSSLSLRKLMVGHNHVQTLPVLVEHIPLEVLDIQHNLLTRLPDTLFSKALNL
RYLNASANSLESLPSASAGEESLSALQLLYLTNNLLTDQCVPVLVGHPHLRILHLANNQL
QTFPASKLNKLEQLEELNLSGNKLKTIPTTIANCKRLHTLVAHSNNISIFPEILQLPQIQ
FVDLSCNDLTEILIPEALPATLQDLDLTGNTNLVLEHKTLDTFSHITTLKIDQKPLPTTD
PTVTSTFWSHGLAEMAGQRNKLCVSSLAVDTFAEGVGAVYGMFDGDRNEELPRLLQCTMA
DVLLEEVQQSSSDTVSMAHTFLVSHRKLGMAGQKLGSSALLCYIRPDTADSTSSFSLTVA
NVGTCQAVLCRGGKPVPLSKVFSLEQDADEAQRVKDQKAIITEDNKVNGVTCCTRMLGCT
YLYPWILPKPYISSTTLTIQDELLILGNKALWEHLSYTEAVSAVRHVQDPLAAAKKLCTL
AQSYGCQDNVGAIVVYLNIGEEGCTCEMNGLSLPGPVGFAPTTTIKDPLKPTTPSSSSGI
ASEFSSEMSTSEVSSEVGSTASDEHNTAGLDASLLPRPERRCSLHPTPTSVVFQRQPSCA
TFSSNQSDNGLDSDDDQPVEGVITNGSKVEVEVDIHCCRGRENSPTLPKNSPAPRPEEHG
RGLFFGIRRQNSVNSGILLPMSKDKMELQKSPSTSCLYGKKLSNGSIVPLEDSLNLIEVA
TEAPKKKTGYFAAPTQLEPEDQFVVPRDLEEEVKEQMKQHQESRPEPELIEEDRTELPEE
FDTAL
Download sequence
Identical sequences G1PC20
ENSMLUP00000007942 ENSMLUP00000007942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]