SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007949 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007949
Domain Number 1 Region: 522-606
Classification Level Classification E-value
Superfamily SH3-domain 6.84e-17
Family SH3-domain 0.0018
Further Details:      
 
Domain Number 2 Region: 171-278
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000000000000419
Family FCH domain 0.017
Further Details:      
 
Domain Number 3 Region: 436-505
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000131
Family SH3-domain 0.0018
Further Details:      
 
Domain Number 4 Region: 18-69
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000000000136
Family FCH domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007949   Gene: ENSMLUG00000008699   Transcript: ENSMLUT00000008723
Sequence length 667
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429795:4220241:4230460:1 gene:ENSMLUG00000008699 transcript:ENSMLUT00000008723 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPPSRKVKPAQEVKLRFLEQLSILQARQQREADLLEDIRSYSKQRAAIEREYGQALQKL
AGPFLKREGYRSGEIDSRWNPRRGRARDQEGMKRSTPGTCGDEGPVIMERSGTGSLSLAC
TLSNLGPLGDIRLLAGSGLNWQSDIPLTIWDHWLLTARLPACLIAPNLSTQSAQYSQQLK
MARNEYLLNLVSTNAHLEHYYQEELPALLKALVSELSEHLRDPLTLLSRTELEAAEMALE
HARRGAQATSQVSWEQDLKLFLQDPEVFSPIPPQKFQPAGNDQVCALELEGVTGGVAGES
DLEKEVQRWTSRAARDYKIQNHGLRVLQRLEQRRQQAPEREALSIEQRLHEVRQSILRAQ
VSQVKGGARLALLQEAGLDVQHWLKPAMTQAQDEVEQEQRLSEARLSQRDLSPTAEDAEL
SDFEDCEETGELFEEPVPPALATRPFPCPAHVVFGYQAGHEDELTITEGEWLEVLEEGDA
DEWVKARNQHSEVGFVPERYLNFPDLSFPESGHDSSMPLGAEPTAFLARALYSYTGQSAE
ELSFPEGALIRLLPRAQDGVDDGFWRGEFGGHVGVFPSLLVEELLGPLGPSESSDPEQML
PSPSPPSFSPPAPTSALDGAPAPVLSGDQDLDCPGPLDMMAPRLRPMRPPPPPPAKAPDP
GRPDPLT
Download sequence
Identical sequences G1PC27
ENSMLUP00000007949 ENSMLUP00000007949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]