SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007953 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007953
Domain Number 1 Region: 150-426
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.71e-55
Family FCH domain 0.0035
Further Details:      
 
Domain Number 2 Region: 28-62
Classification Level Classification E-value
Superfamily WW domain 0.0000000252
Family WW domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007953   Gene: ENSMLUG00000008721   Transcript: ENSMLUT00000008728
Sequence length 428
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430049:117511:192697:-1 gene:ENSMLUG00000008721 transcript:ENSMLUT00000008728 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPDVCDLSFPPPQKPGMVPPPPGEESQSIVLPPGWQSYLSPQGRRYYVNTTTNAETTWER
PSGSGIPASPGTHRSPLPPTVNGYHASGTPAHPPETAHMSVRKSAADPQNLGSSSPGRKQ
SKENTITINCVTFPHPDTMPEQQLLKPTEWSYCDYFWADKKDPQGNGNVAGFELLLQKQL
KGKQMQKEMSEFIRERIKIEEEYAKNLAKLSQNSLAAQEEGSLGEAWAQVKKSLADEAEV
HLKFSAKLHSEVEKPLMNFRENFKKDMKKCDHHIADLRKQLASRYAAVEKARKALTERQR
DLEMKTQQLEIKLSNKTEEDIKKARRKSTQAGDDLMRCVDLYNQAQSKWFEEMVTTTLEL
ERLEVERVEMIRQHLCQYTQLRHETDMFNQSTVEPVDQLLRKVDPAKDRELWVREHKTGN
IRPVDMEI
Download sequence
Identical sequences G1PC30
ENSMLUP00000007953 ENSMLUP00000007953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]