SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Myotis lucifugus 76_2.0 > ENSMLUP00000007981

Domain assignment for ENSMLUP00000007981 from Myotis lucifugus 76_2.0

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSMLUP00000007981
Domain Number 1	Region: 156-294
Classification Level	Classification	E-value
Superfamily	SH2 domain	5.12e-27
Family	SH2 domain	0.00039
Further Details:

Domain Number 2	Region: 40-94
Classification Level	Classification	E-value
Superfamily	SH3-domain	2.23e-21
Family	SH3-domain	0.00077
Further Details:

Domain Number 3	Region: 121-203
Classification Level	Classification	E-value
Superfamily	SH3-domain	6.69e-21
Family	SH3-domain	0.0000285
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Biological Process	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSMLUP00000007981 Gene: ENSMLUG00000008767 Transcript: ENSMLUT00000008759
Sequence length	304
Comment	pep:known_by_projection scaffold:Myoluc2.0:GL430220:346114:359787:1 gene:ENSMLUG00000008767 transcript:ENSMLUT00000008759 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	GLGKTKRKTSARDASPTPSTDAEYPANGGADRIYDLNIPAFVKFAYVAEREDELSLVKGS RVTVMEKCSDGWWRGSYNGQIGWFPSNYVLEEVDEAAAESPSFPSLRRGAPVSNGQGARV LHVVQTLYPFSSVTEEELNFEKGETMEVIEKPENDPEWWKCKNARGQVGLVPKNYVVVLS DGPVLPPSHVPQISYPGPAGSGRFAGREWYYGNVTRHQAECALNERGREGDFLIRDSESS PSDFSVSLKASGKNKHFKVQLVDSVYCIGQRRFHTMDELVEHYKKAPIFTSERGEKLYLV RALQ
Download sequence
Identical sequences	G1PC51 ENSMLUP00000007981 ENSMLUP00000007981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]