SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000008018 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000008018
Domain Number 1 Region: 231-498
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.7e-84
Family Protein kinases, catalytic subunit 0.000000000117
Further Details:      
 
Domain Number 2 Region: 122-262
Classification Level Classification E-value
Superfamily SH2 domain 1.88e-37
Family SH2 domain 0.00000134
Further Details:      
 
Domain Number 3 Region: 62-147
Classification Level Classification E-value
Superfamily SH3-domain 5.25e-20
Family SH3-domain 0.000023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000008018   Gene: ENSMLUG00000008799   Transcript: ENSMLUT00000008799
Sequence length 1130
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430480:22195:62999:-1 gene:ENSMLUG00000008799 transcript:ENSMLUT00000008799 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLEICLKLVGCKSKKGLSSSSSCYLEEALQRPVASDFEPQGLSEAARWNSKENLLAGPSE
NDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVN
SLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRVYHYRINTAS
DGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRNKPTVYGVSPNYDKWEMERT
DITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQ
LLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFI
HRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKS
DVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNP
SDRPSFAEIHQAFETMFQESSISDEVEKELGKKGLRGVAGTLLQPELPTKTRTSRRATEH
KDATDLPEAPHSKGPGEPDPLDHEPAVSPLLPRKERGPQDGCLNEDERLLPKDKKTNLFS
ALIKKKKKTAPTPPKRSSSFREMDGQPERKGAGEEEGREVSNGAPALTPSDTAEPAKSPK
PSSGAGVPNGAFRESGGAGFRSPHLWKKSSTLTSSRLAASEEESGSSASKRFLRSCSASC
VPHGAKDTEWRSVTLPRDLQSTGRQFDSSTFGGHKSEKPALPRKRASETRSDQVARGTVT
PPPRLVKKMEELADEVFKDTAESSPGSSPPSLTPKLLRRQVVVVPSSGLPHKDEAGKSSA
LGTPAAAEPVPATSRAGPGAPGGTSKAPVEESRMRRHKPSSESPGRDKGKLSKLKPAPPP
PLPASVGKAGRPSPSLSQEAAGEAGASGKAKSTAVVVDAVNSDAAKPSQLGEGVKKPVLL
SMPKPQSSTKPAGTPTSPVPTPSTLPSASSALAGDQLSSTAFIPLISTRVSLRKTRQPPE
RIASGAITKGVVLDSTEALCLAISKNSEQMASHSAVLEAGKNLYTFCVSYVDSIQQMRNK
FAFREAINKLENNLRELQICPATAGSGPAATQDFSKLLSSVKEISDIVQR
Download sequence
Identical sequences G1PC86
ENSMLUP00000008018 ENSMLUP00000008018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]