SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000008037 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000008037
Domain Number 1 Region: 553-678
Classification Level Classification E-value
Superfamily PH domain-like 6.16e-19
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 
Domain Number 2 Region: 84-249
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000341
Family Clathrin adaptor core protein 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000008037   Gene: ENSMLUG00000008785   Transcript: ENSMLUT00000008819
Sequence length 732
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429857:2827424:2851398:1 gene:ENSMLUG00000008785 transcript:ENSMLUT00000008819 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPPSDIVKVAIEWPGANAQLLEIDQKRPLASIIKEVCDGWSLPNPEYYTLRYADGPQLY
ITEQTRSDIKNGTILQLAISPSRAARQLMERTQSSSMETRLDAMKELAKLSADVTFATEF
INMDGIVVLTRLVESGTKLLSHYSEMLAFTLTAFLELMDHGIVSWDMVSITFIKQIAGYV
SQPMVDVSILQRSLAILESMVLNSQSLYQKIAEEITVGQLISHLQVSNQEIQTYAIALIN
ALFLKAPEDKRQDKHLNPLDLPATDMANAFAQKHLRSIILNHVIRGNRPIKTEMAHQLYV
LQVLTFNLLEERMMTKMDPNDQAQRDIIFELRRIAFDAESDPSNVPGSGTEKRKAMYTKD
YKMLGFTNHINPAMDFTQTPPGMLALDNMLYLAKVHQDTYIRIVLENSSREDKHECPFGR
SAIELTKMLCEILQVGELPNEGRNDYHPMFFTHDRAFEELFGICIQLLNKTWKEMRATAE
DFNKVMQVVREQITRALPSKPNSLDQFKSKLRSLSYSEILRLRQSERMSQDDFQSPPIVE
LREKIQPEILELIKQQRLNRLCEGSSFRKIGNRRRQERFWYCRLALNHKVLHYGDLDDNP
QGEVTFESLQEKIPVADIKAIVTGKDCPHMKEKSALKQNKEVLELAFSILYDPDETLNFI
APNKYEYCIWIDGLSALLGKDMSSELTKSDLDTLLSMEMKLRLLDLENVQIPEAPPPVPK
EPSSYDFVYHYG
Download sequence
Identical sequences G1PCA3 S7P4S6
XP_006091409.1.53796 XP_008157238.1.99482 XP_014313555.1.53796 XP_014391843.1.60319 ENSMLUP00000008037 ENSMLUP00000008037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]