SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000008066 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000008066
Domain Number 1 Region: 852-963
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 3.01e-40
Family Pyk2-associated protein beta ARF-GAP domain 0.00036
Further Details:      
 
Domain Number 2 Region: 318-489
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.15e-29
Family G proteins 0.0000000348
Further Details:      
 
Domain Number 3 Region: 589-654,792-835
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000417
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000008066
Domain Number - Region: 184-266
Classification Level Classification E-value
Superfamily Bacterial luciferase-like 0.00542
Family F420 dependent oxidoreductases 0.038
Further Details:      
 
Domain Number - Region: 975-1030
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00593
Family Ankyrin repeat 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000008066   Gene: ENSMLUG00000008775   Transcript: ENSMLUT00000008852
Sequence length 1030
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429886:1967708:1980362:1 gene:ENSMLUG00000008775 transcript:ENSMLUT00000008852 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLGCSEPPGLSLQEAPSPPSYPDSRAGGEKRLSLWAAPPGPPHSGGLSPDPKPGAAPTSS
RRPLLSSPSWGGPEPEGRAGGGVPGSSSPHPGTGSRRLKVAPPPPAPKPCKTVTTSGAKA
GAGKGAGSRLSWPESEGKPRVKGSKSSAGTGAAAAAAAGAGGAAATTSGGVGAGPGARGK
LSPRKGKSKTLDNSDLHPGPPAGSPPPLTLPATSAPGAALTVAAAMPTGPAPPNTLEPPA
PGLKRGREGGRASTRDRKMLKFISGIFTKSTGGPPGSGPPAGPPGLSSGSGSRELLGTEL
RTSPKAVVNSQEWTLSRSIPELRLGVLGDARSGKSSLIHRFLTGSYQVLEKTESEQHKKE
MLVDGQTHLVLIREEAGAPDAKFSGWADAVILVFSLEDENSFQAVSRLHGQLSSLRGEGR
GGLALALVGTQDRISASSPRVVGDARARALCADMKRCSYYETCATYGLNVDRVFQEVAQK
VVTLRKQQQLLAACKSLPSSPSHSAASTPVAGQASNGGHTSDYSSSLPSSPNVGHRELRA
EAVAVAGLSTPGSLHRAAKRRTSLFANRRGSDSEKRSLDSRGETTGSGRAIPIKQSFLLK
RSGNSLNKEWKKKYVTLSSNGFLLYHPSINDYIHSTHGKEMDLLRTTVKVPGKRPPRAIS
AFGPSASINGLVKDMSTVQMGEGPEATTPTPSSSPSPSSLQPPSDQTSKHLLKPDRNLAR
ALSTDCTPSGDLSPLSREPPPSPMVKKQRRKKLTTPSKTEGSSGQAEGKPAKRKMWKLKS
FGSLRNIYKAEENFEFLIVSSTGQTWHFEAASFEERDAWVQAIESQILASLQCCESSKVK
LRTDSQSEAVAIQAIRNAKGNCICVDCGAPNPTWASLNLGALICIECSGIHRNLGTHLSR
VRSLDLDDWPRELTLVLTAIGNDMANRVWESNTRGRAKPTRDSSREERESWIRAKYEQLL
FLAPLGSPEEPLGRQLWAAVQAQDVAAVLLLLAHARHGPLDTSVEDPQLRSPLHLAAELA
HVVITQLLLW
Download sequence
Identical sequences G1PCC8
ENSMLUP00000008066 ENSMLUP00000008066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]