SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000008090 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000008090
Domain Number 1 Region: 129-157,185-422
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.36e-66
Family Nuclear receptor ligand-binding domain 0.00000000182
Further Details:      
 
Domain Number 2 Region: 76-151
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.04e-28
Family Nuclear receptor 0.0000271
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000008090   Gene: ENSMLUG00000008880   Transcript: ENSMLUT00000008878
Sequence length 424
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430612:17938:24029:-1 gene:ENSMLUG00000008880 transcript:ENSMLUT00000008878 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSQVVGIEPLYIKAEPASPDSPKGSSETETEPPVALAPGPAPARHLPGHKEEEDGEGAG
PGEQGGGKLVLSSLPKRLCLVCGDVASGYHYGVASCEACKAFFKRTIQGSIEYSCPASNE
CEITKRRRKACQACRFTKCLRVGMLKEVQGVRLDRVRGGRQKYKRRPEVDPLPFPGPFPA
GPLAVAGGPRKTAPVNALVSHLLVVEPEKLYAMPDPAGPDGHLPAVATLCDLFDREIVVT
ISWAKSIPGFSSLSLSDQMSVLQSVWMEVLVLGVAQRSLPLQDELAFAEDLVLDEEGARA
AGLGELGAALLQLVRRLQALRLEREEYVLLKALALANSDSVHIEDAEAVEQLREALHEAL
LEYEAGRAGPGGGAERRRAGRLLLTLPLLRQTAGKVLAHFYGVKLEGKVPMHKLFLEMLE
AMMD
Download sequence
Identical sequences G1PCE9
ENSMLUP00000008090 ENSMLUP00000008090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]