SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000008092 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000008092
Domain Number 1 Region: 392-452
Classification Level Classification E-value
Superfamily SH3-domain 1.77e-22
Family SH3-domain 0.00054
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000008092
Domain Number - Region: 30-86
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.00611
Family SNARE fusion complex 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000008092   Gene: ENSMLUG00000008872   Transcript: ENSMLUT00000008880
Sequence length 458
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430073:586058:644393:-1 gene:ENSMLUG00000008872 transcript:ENSMLUT00000008880 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LIEISAMALQVSDYHQNGPFFATDKRKALEETKAYTTQSLASVAYQINALANNVLQLLDI
QASQLRRMESSINHISQTVDIHKEKVARREIGILTTNKNTSRTHKIIAPANMERPVRYIR
KPIDYTVLDDVGHGVKHGNNQPARTGTLSRTNPPTQKPPSPPMSGRGTLGRNTPYKTLEP
VKPPTVPNDYMTSPARLGSQHSPGRTASLNQRPRTHSGSSGGSGSRENSGSSSIGIPIAV
PTPSPPTIGSAAPGSAPGSQYGTMTRQISRHNSTTSSTSSGGYRRTPSVTAQFSAQPHVN
GGPLYSQNSISIAPPPPPMPQLTPQIPLTGFVARVQENIADSPTPPPPPPPDDIPMFDDS
PPPPPPPPVDYEDEEAAVVQYNDPYADGDPAWAPKNYIEKVVAIYDYTKDKDDELSFMEG
AIIYVIKKNDDGWYEGVCNRVTGLFPGNYVESIMHYTD
Download sequence
Identical sequences G1PCF1
ENSMLUP00000008092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]