SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000008101 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000008101
Domain Number 1 Region: 161-242
Classification Level Classification E-value
Superfamily HMG-box 7.85e-22
Family HMG-box 0.00000477
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000008101   Gene: ENSMLUG00000008891   Transcript: ENSMLUT00000008889
Sequence length 262
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429949:423654:443744:1 gene:ENSMLUG00000008891 transcript:ENSMLUT00000008889 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SNKVPVVQPSHAVHPLTPLITYSDEHFSPGTHPSHIPSDVNSKQVGMSRHPPAPEIPTFY
PLSPGGVGQITPPLGWQGQPVYPITGGFRQPYPSSLSVDTSMSRFSHHMIPGPPGPHTTG
IPHPAIVTPQVKQEHPHTDGDLMHVKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANV
VAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKK
RKREKLQESTSGTGPRMTAAYI
Download sequence
Identical sequences G1PCG0
ENSMLUP00000008101 ENSMLUP00000008101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]