SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000008125 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000008125
Domain Number 1 Region: 1-85
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.96e-29
Family Ras-binding domain, RBD 0.00000557
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000008125
Domain Number - Region: 150-349
Classification Level Classification E-value
Superfamily Tropomyosin 0.00647
Family Tropomyosin 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000008125   Gene: ENSMLUG00000008918   Transcript: ENSMLUT00000008917
Sequence length 421
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429845:62293:70872:-1 gene:ENSMLUG00000008918 transcript:ENSMLUT00000008917 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELKVWVDGVQRIVCGVTEVTTCQEVVIALAQAIDLGRTGRYTLIEKWRDTERHLAPHEN
PIISLNKWGQYASDVQLILRRTGPSLSERPTSDSVARIPERTLYRQSLPPLAKLRPQVDK
SIKRREPKRKSLTFTGGAKGLMDIFGKGKETEFKQKVLNNCRTTADELKKLIRLQTEKLQ
SIEKELKSNEIEIQFWEQKYNSNLEEEIVRLEQKIKRNDVEIEEEEFWENELQIEQENEK
QLKDQLQEIRQKITECESKLKDYLAQIQTMENGLEAEKLQREVQEAQVNEEEVKGKIGKV
KGEIDVQGQQSLRLENGIKAVERSLGQATKRLQDKEQELEQLTKELRQVNLQQFIQQTGT
KVTVLPAEPIEVEASHIDIEREAAFQSGSLKRPGSSRQLPTNLRILQNPISSGFNPEGIY
V
Download sequence
Identical sequences G1PCI4
ENSMLUP00000008125 ENSMLUP00000008125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]