SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000008144 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000008144
Domain Number 1 Region: 3-222
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 7.32e-56
Family FCH domain 0.00000000308
Further Details:      
 
Domain Number 2 Region: 426-444,484-540
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000433
Family SH3-domain 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000008144
Domain Number - Region: 338-407
Classification Level Classification E-value
Superfamily DnaK suppressor protein DksA, alpha-hairpin domain 0.00288
Family DnaK suppressor protein DksA, alpha-hairpin domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000008144   Gene: ENSMLUG00000008934   Transcript: ENSMLUT00000008937
Sequence length 543
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430510:72087:82211:1 gene:ENSMLUG00000008934 transcript:ENSMLUT00000008937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RFSQQQSFVQILQEVNDFAGQRELVAENLSVHVCLELAKYSQEMKQERKMHFQEGRRAQQ
QLESGFKQLENSKRKFERDCREAEKAAQTAERLDQDINATKADVEKAKQQAHLRSHMAEE
SKNEYAAQLQRFNRDQAHFYFSQMPQIFDKLQDMDERRATHLGAGYGLLSEAELQVLPII
TKCLEGMKVAAAAVDSKNDSQVLIELNKSGFARPGDVEFEDFSQPMNRTHSDSSLGTPSD
GRPELRGPGRSRAKRWPFGKKNKPHPQSLSPLGGPLPSALPNGPPSPRSGLDPLAILSEL
SKSVKPRLASFRSFRGSRGLSFHLQTVVTEDFSHLPPEQQRKRLQQQLEERNRELQKEID
QREALKKMKDVYEKTPQMGDPTSLEPQIAETLNNIERLKLEVQKYEAWLAEAESRVLSNR
GDSLSRHTRPPDPPASAPPDSSSSSNSGSQENKESSEEPPLEEGQDTPIYTEFDEDFEES
ASPIGHCVAIYHFEGSSEGTISMAEGEDLSLMEEDKGDGWTRVRRKQGGEGYVPTSYLRV
TLN
Download sequence
Identical sequences G1PCK0
ENSMLUP00000008144 ENSMLUP00000008144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]