SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000008179 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000008179
Domain Number 1 Region: 176-444
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.02e-46
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 2 Region: 7-141
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.63e-36
Family Ankyrin repeat 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000008179   Gene: ENSMLUG00000008954   Transcript: ENSMLUT00000008973
Sequence length 452
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430462:242220:248447:1 gene:ENSMLUG00000008954 transcript:ENSMLUT00000008973 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARI
NVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLV
ANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNG
TLNKHSGIDFKQLHFIAQINQNHSGELWKGRWQGNDIVMKVLKVRDWSTRKSRDFNEECP
RLRIFSHPNVLPVLGFCHAPPAPHPTLITHLMPHGSLYNILHEGTNLVVDQSQAVKFALD
MARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQCPGRMYAPAWVAPEA
LQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPH
VCKLMKICMNEDPAKRPKFDMIVPILEKMQDK
Download sequence
Identical sequences G1PCN1
XP_006105625.1.53796 ENSMLUP00000008179 ENSMLUP00000008179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]