SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000008233 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000008233
Domain Number 1 Region: 104-312
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-53
Family DBL homology domain (DH-domain) 0.000063
Further Details:      
 
Domain Number 2 Region: 324-447
Classification Level Classification E-value
Superfamily PH domain-like 6.58e-20
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000008233   Gene: ENSMLUG00000009032   Transcript: ENSMLUT00000009038
Sequence length 527
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429850:3819538:3879975:-1 gene:ENSMLUG00000009032 transcript:ENSMLUT00000009038 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAKDYPFYLSVKRANCSLEVPPASSPAKDAEEPSNKRVKPLSRVTSLANLIPPVKATPL
KRFSQTLQRSISFRSESRPDILTPRPWSRNAAPSSTKRRDSKLWSETFDVCVNQMLTSKE
IKRQEAIFELSQGEEDLIEDLKLAKKAYHDPMLKLSIMTEQELNQIFGTLDSLIPLHEEL
LSQLRDVRKPDGSTEHVGAILVGWLPCLSSYDSYCSNQVAAKALLDHKKQDHRVQDFLQR
CLESPFSRKLDLWNFLDIPRSRLVKYPLLLREILRHTPNDNPDQQHLEEAINIIQGIVAE
INIKTGESECHYYKERLLYLEEGQKDSLIDSSRVLCCHGELKNNRGMKLHVFLFQEVLVI
TRAITHNEQLCYQLYRQPIPVKDLLLEDLQDGEVRLGGSLRGAFSNNERIKNFFRVSFKN
GSQSQTHSLQANDTFNKQQWLNCIRQAKETVLCAAGQAGVLDSEGPFLNPAAAGSKEPQG
ETKLEQMDQSDSDSDCSMDTSEVSLDCERMEQTDSSCGNSKHVESNV
Download sequence
Identical sequences G1PCS4
ENSMLUP00000008233 ENSMLUP00000008233 XP_006090925.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]