SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000008312 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000008312
Domain Number 1 Region: 84-197
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 1.11e-26
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0037
Further Details:      
 
Domain Number 2 Region: 283-336
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 6.28e-16
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0043
Further Details:      
 
Domain Number 3 Region: 199-267
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.00000000000000102
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0071
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000008312
Domain Number - Region: 421-477
Classification Level Classification E-value
Superfamily EF-hand 0.0116
Family Calbindin D9K 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000008312   Gene: ENSMLUG00000009111   Transcript: ENSMLUT00000009124
Sequence length 842
Comment pep:novel scaffold:Myoluc2.0:GL429975:1864000:1893379:-1 gene:ENSMLUG00000009111 transcript:ENSMLUT00000009124 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKEKKKTDKKVDKSAHSPSSLSDNPELSKPDGNSTRQVVSPIIVPQLGLSEPGSKRESR
NENQPLEDALQYEDPILTNLIIESYEGEKVHGLYQGEGFAVFQGGCTYRGMFSEGLMHGQ
GTYIWADGVKYEGEFVKNIPMNRGVYTWPDGSTYEGEVINGMRNGFGVFKCSTQPVSYIG
HWCQGKRHGKGSIYYNEEGTSCYEGDWVHNIKKGWGIRRYKSGNMYEGQWENNMRHGEGT
MKWLTTNEEYSGQWENGVQNGLGTHTWFLKRVPNTQYPLRNEYRGNFVDGCRHGHGKFYY
ASGAIYEGEWVSNKKHGMGQLTFKNGRVYTGPFSSDHIAEFLSLDDELVHYQAPSAVSVL
GSQCEGSSSAEIIRRLNGSESKSALGSSIELDLILLLNMYPKREQPEEKKQVEYAILRNI
TELRRIYTFYSRLGCEQSPDNTFLMTKLQFWRFLKDCKFHHHKITLADMDRVISEYSGIP
VEEIHSPFTKILLRIFLTYLLQLAYHIHHKEYQHRSPSLFLCFTKLMTENIHPNACCVKG
SLFSGQQRSLYSMNYIDMCWEIYLAYCRPSTAPPHEPTMTMRHFLWMLKDFKMINKELTS
TKFVEVIAEDNPSMSDGIDSNLELELVFLEFFEALLSFASISVTDQMTKSHVSVLCDDFT
GNRAGISYLPTDTSDHQNRSLSAAPIQESDVHLVNTMLSSTKLALLLDFSKIQITEPKFR
KSLSDDRISKMTIKSPGKGLTFSLPPSAYRHEETLKEKIKENTLHYTAMAKRRKTENDEL
EARLLMLELKEEEVKKQDHHMVDITVIKEPVDIPSLHVMLGLPKEAQVLGLSKSFISKKK
KK
Download sequence
Identical sequences G1PCZ6
ENSMLUP00000008312 ENSMLUP00000008312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]