SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000008335 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000008335
Domain Number 1 Region: 39-791
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.84e-264
Family Motor proteins 0.000000000158
Further Details:      
 
Domain Number 2 Region: 1203-1300
Classification Level Classification E-value
Superfamily PH domain-like 2.31e-28
Family Pleckstrin-homology domain (PH domain) 0.0082
Further Details:      
 
Domain Number 3 Region: 1383-1502
Classification Level Classification E-value
Superfamily PH domain-like 8.31e-22
Family Pleckstrin-homology domain (PH domain) 0.0086
Further Details:      
 
Domain Number 4 Region: 1786-1855,1898-1942
Classification Level Classification E-value
Superfamily Second domain of FERM 3.37e-18
Family Second domain of FERM 0.0078
Further Details:      
 
Domain Number 5 Region: 1321-1376
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000207
Family Pleckstrin-homology domain (PH domain) 0.0068
Further Details:      
 
Domain Number 6 Region: 1166-1204
Classification Level Classification E-value
Superfamily PH domain-like 0.000000178
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000008335
Domain Number - Region: 1694-1779
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0269
Family Ras-binding domain, RBD 0.023
Further Details:      
 
Domain Number - Region: 832-924,1206-1231
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0324
Family BAR domain 0.061
Further Details:      
 
Domain Number - Region: 1946-2032
Classification Level Classification E-value
Superfamily PH domain-like 0.0676
Family Third domain of FERM 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000008335   Gene: ENSMLUG00000009101   Transcript: ENSMLUT00000009147
Sequence length 2050
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429767:61176391:61331274:1 gene:ENSMLUG00000009101 transcript:ENSMLUT00000009147 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGTRVWLRENGQHFPSTVNSCAEGVVVFQTDYGQVFTYKQSTITHQKVTAMHPMNEEGVE
DMATLTELHGGSIMHNLHQRYKRDQIYTYIGSIIASVNPYKPIAGLYERATMERYSKSHL
GELPPHVFAVANECYRCLWKRHDNQCVLISGESGAGKTESTKLILKFLSVISQQSLELSL
KEKTSCVEQAILESSPIMEAFGNAKTVYNNNSSRFGKFVQLNICQKGNIQGGRIVDYLLE
KNRVVRQNPGERNYHIFYALLAGLEGEQREEFYLSVPENYHYLNQSGCVEDKTISDQESF
REVITAMDVMQFSKEEVREVLRLLAGILHLGNIEFITAGGAQVSFKTALGRSAELLGLDP
TQLTDALTQRSMFLRGEEILTPLSVQQAVDSRDSLAMALYARCFEWVIKKINSRIKGKDD
FKSIGILDIFGFENFEVNHFEQFNINYANEKLQEYFNKHIFSLEQLEYSREGLVWEDIDW
IDNGECLDLIEKKLGLLALINEESHFPQATDSTLLEKLHNQHANNHFYVKPRVAVNNFGV
KHYAGEVQYDVRGILEKNRDTFRDDLLNLLRESRFDFIYDLFEHVSSRNSQDTLKCGSKH
RRPTVSSQFKDSLHSLMATLSASNPFFVRCVKPNMQKMPDQFDQAVVLNQLRYSGMLETV
RIRKAGYAVTLAPLAPLRCRYKVLMQNVAVPEDIRGKCTALLQLYDSSHSEWQLGKTKVF
LRESLEQKLERLREEEVTRAAMVIRAHVLGYLARKQYRKVLSCVVMIQKNYRAFLLRRRF
LHLRRAAIVFQKQVRGQRARRVYRQLLAEKREAEAKRRWEEEEKRRREQEERERERARRE
AELHAQQEAAERKRQELEALQKSQREAELHRELEKQKENKQVEEILRLEKEIEDLQRMKE
QQELSLTEASLQKLQQLRDQELKRLEDEACRAAQEFLESLNFDEIDECVRNIERSLSVGS
EFSGELGDLAESASGEKPTFNFSQPYPEEEVDEGFEAEDDAFKDSPNPSEHGHSDQRTSG
IRTSDESSEEDPYMNETVVPTSPSADSTVLLAPSEQSSSSGEPTYCLPQNAGGLPSPEGD
YDYDQDDYEDGAVTSSSSVTFSNSYSSQWSPDYRCSVGTYNSSGAYRFSSEGAQSSFEDS
EEDFDSRFDTDDELSYRRDSVYSCVTLPYFHSFLYMKGGLMNSWKRRWCVLKDETFLWFR
SKQEALKQGWLHKKGGGSSTLSRRNWKRRWFVLRQSKLMYFENDSEEKLKGTVEIRTAKE
IIDNTSKENGIDIIMADRTFHLIAESPEDASQWFSVLSQVHASTDQEIREMHDEQANPQN
AVGTLDVGLIDSVCASDSPDRPNSFVIITANRVLHCNADTPEEMHHWITLLQRSKGDTRV
EGQEFIVRGWLHKEVKNSPKMSSLKLKKRWFVLTHNSLDYYKSSEKNALKLGTLVLNSLC
SVVPPDEKVFKETGYWNVTVYGRKHCYRLYTKLLNEATRWSSAIQNVTDTKAPIDTPTQQ
LIQDIKENCLNSDVVEQIYKRNPILRHTHHPLHSPLLPLPYGDINLNLLKDKGYTTLQDE
AIKIFNSLQQLESMSDPIPIIQGILQTGHDLRPLRDELYCQLIKQTNKVPHPGSAGNLCS
WQILTCLSCAFLPSRGILKYLKFHLKRIREQFPGTEMEKYALFIYESLKKTKCREFVPSR
DEIEALIHRQEMTSMVYCHGGGSCKITINSHTTAGEVVEKLIRGLAMEDSRNMFALFESN
GHVDKAIESRTIVADVLAKFEKLAATSEVGDLPWKFYFKLYCFLDTDNVPKDSVEFAFMF
EQAHEAVIHGHYPAPEENLQVLAALRLQYLQGDYSLHSAVPPLEEVYSLQRLKARISQAT
KSCAPCERQRRTSFLEGTLRRSFRTGTGAVVRQKAEEEQMLDMWIKEEVSAARASIIDKW
KKFQGMSQEQAMAKYMAVIKEWPGYGSTLFDVECKEGGFPQDLWLGVSADAVSVYKRGEG
RPLEVFQYEHILSFGAPLANTYKIVVDERELLFETSEVVDVAKLMKAYISMIVKKRYSTS
RSVSSQGSSR
Download sequence
Identical sequences G1PD16
ENSMLUP00000008335 ENSMLUP00000008335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]