SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000008350 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000008350
Domain Number 1 Region: 8-39,87-135
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.86e-22
Family Ras-binding domain, RBD 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000008350   Gene: ENSMLUG00000009160   Transcript: ENSMLUT00000009162
Sequence length 504
Comment pep:novel scaffold:Myoluc2.0:GL429828:1771801:1773315:-1 gene:ENSMLUG00000009160 transcript:ENSMLUT00000009162 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPSEKKISVWICQEEKLVSGLSRRTTCSDVVRVLLEDGWRRRRKQRRGRRRGAAASDPP
GPGELPEPLDEDDEDDEETLPPGLLCGPPQCYCIVEKWRGFERILPNKTRILRLWAAWGD
EQENVRFVLVRSEASLPNAGPRSAEARVVLSRERPCSARGVPARPSLALTQEKQRRVVRK
AFRKLAKLNRRRQQQPASPCSSTSSSTASSCSSSPRAADSVSVERMETLVHLVLSQDHTI
RQQVQRLRELDREIDRYEAKVHLDRMRRHGVNYVQDTYLLDAGIELDGPSPGEEPEPEAV
AMAAAPLDGQGQVVALEELAQRCDDLLKLQEQRAQQEELLERLSAEIQEELNQRWMRRRQ
EELAAREECPEPDGSLDGELLLEQERVRTQLSTSLYIGLRLNTDLEALKSDLDYSQQQWD
SKERELQGLLQTLHTLELTVAPDGTPGSGGPSRESRPQPGAEVWVDQARGLAKSCPGNDE
DSDTGLSSMHSQDSDSVPVCESLV
Download sequence
Identical sequences G1PD29
ENSMLUP00000008350 ENSMLUP00000008350 XP_014312081.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]