SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000008389 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000008389
Domain Number 1 Region: 260-450
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.4e-53
Family cAMP-binding domain 0.00000000555
Further Details:      
 
Domain Number 2 Region: 2-263
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.01e-34
Family Voltage-gated potassium channels 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000008389   Gene: ENSMLUG00000009201   Transcript: ENSMLUT00000009203
Sequence length 684
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430150:889767:908839:-1 gene:ENSMLUG00000009201 transcript:ENSMLUT00000009203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RFYWDFTMLLFMVGNLIIIPVGITFFKDETTAPWIVFNVVSDTFFLMDLVLNFRTGIVIE
DNTEIILDPEKIKKKYLRTWFVVDFVSSIPVDYIFLIVEKGIDSEVYKTARALRIVRFTK
ILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVMRICNLISMMLLLCHWDGCLQFLVPM
LQDFPRNCWVSINGMVNHSWSELYSFALFKAMSHMLCIGYGRQAPESMTDIWLTMLSMIV
GATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQG
KMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDY
IIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRL
YSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILLHKVQHDLNSGVFNNQENAI
IQEIVKYDREMVQQAELGQRVGLFPPPPPPQVTSAIATLQQAVAMSFCPQVARPLVGPLA
LSSPRLVRRLPPGPVPAATASPGPPPAASPPGAPASPRAPRTSPYGGAPCSPAAPRAGPA
LPARRLSRASRPLSASQPSLPHGAPGPGPAASARPASSSTPRLGPISTTRAAGPSPDRRD
SALPSVTGGLDPLDSARSRLSSNL
Download sequence
Identical sequences G1PD62
ENSMLUP00000008389 ENSMLUP00000008389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]