SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000008400 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000008400
Domain Number 1 Region: 374-735
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 1.31e-118
Family Oxysterol-binding protein 0.00001
Further Details:      
 
Domain Number 2 Region: 13-120
Classification Level Classification E-value
Superfamily PH domain-like 4.88e-24
Family Pleckstrin-homology domain (PH domain) 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000008400   Gene: ENSMLUG00000009199   Transcript: ENSMLUT00000009216
Sequence length 741
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429804:6402947:6535809:1 gene:ENSMLUG00000009199 transcript:ENSMLUT00000009216 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPYRRMTSGRLLSLAAPKMASIMEGPLSKWTNVMKGWQYRWFVLDYNAGLLSYYTSKDKM
MRGSRRGCVRLRGAVIGIDDEDDSTFTITVDQKTFHFQARDADEREKWIHALEETILRHT
LQLQGLDSGFVPSVQDFDKKLTEADAYLQILIEQLKLFDDKLQNCKDDEQRKKIETLKET
TNSMVESIKHCIVLLQIAKSTINPVDAIYQPSPLEPVINTMPSQTVLPPEPAQLCKSEQR
PSSLPVGPVLATLGHHQTPTPNSTGSGHSPPSSSLTSPSHVNLSPNTVPEFSYSSSEDEF
YDADEFHQSGSSPKRLIDSSGSASVLTHSSSGNSLKRPDTTESLNSSMSNGTSDADLFDS
YDDRDDEGEAGSVEEHKSVIMHLLSQVRLGMDLTKVVLPTFILERRSLLEMYADFFAHPD
LFVSISDQKDARDRMVQVVKWYLSAFHAGRRGSVAKKPYNPILGEIFQCHWTLPNDTEEN
TELVSEGPVPGVSKNSVTFVAEQVSHHPPISAFYAECFNKKIQFNAHIWTKSKFLGMSIG
VHNIGQGCVSCLDHDEHYILTFPNGYGRSILTVPWVELGGECNINCSKTGYSANIVFHTK
PFYGGKKHRITAEIFSPNDKKSFCSIEGEWNGVMYVKYATGENAVFIDTKKLPIIKKKVR
KLEDQNEYESRCLWKDVTFNLKIRDIDAATEAKHRLEERQRAEARERKEKEIQWETRLFH
EDGECWVYDEPLLKRLGAAKH
Download sequence
Identical sequences G1PD73
ENSMLUP00000008400 ENSMLUP00000008400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]