SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000008418 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000008418
Domain Number 1 Region: 701-1062
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.89e-89
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.0000000549
Further Details:      
 
Domain Number 2 Region: 520-698
Classification Level Classification E-value
Superfamily ARM repeat 9.36e-64
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.0000253
Further Details:      
 
Domain Number 3 Region: 107-297
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.82e-48
Family Ras-binding domain, RBD 0.00086
Further Details:      
 
Domain Number 4 Region: 332-473
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.27e-44
Family PLC-like (P variant) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000008418   Gene: ENSMLUG00000009229   Transcript: ENSMLUT00000009236
Sequence length 1070
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429781:14494362:14525922:-1 gene:ENSMLUG00000009229 transcript:ENSMLUT00000009236 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLVTIKHELFKEARKYPLH
QLLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGF
AIGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNVESSPELPK
HIYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDYVPEQVIAEAIRKKTRSMLLSSEQL
KLCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPM
DCFTMPSYSRRISTATPYMNGETSTKSLWGINSALRIKILCATYVNVNIRDIDKIYVRTG
IYHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEH
CPLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLEMEFDW
FSSSVVKFPDMSVIEEHANWSVSREAGFSYSHAGPSNRLARDNELRENDKEQLRAICTRD
PLSEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQA
MELLDCNYPDPMVRSFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKAL
TNQRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDI
LKQEKKDETQKVQMKFLVEQMRRPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRP
LWLNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGC
LSIGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFT
RSCAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQ
DFLIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDD
IAYIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
Download sequence
Identical sequences G1PD89
ENSMLUP00000008418 ENSMLUP00000008418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]