SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000008430 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000008430
Domain Number 1 Region: 295-707
Classification Level Classification E-value
Superfamily Nitric oxide (NO) synthase oxygenase domain 5.63e-201
Family Nitric oxide (NO) synthase oxygenase domain 0.000000000000193
Further Details:      
 
Domain Number 2 Region: 967-1234
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 3.59e-80
Family NADPH-cytochrome p450 reductase FAD-binding domain-like 0.000000000417
Further Details:      
 
Domain Number 3 Region: 754-951
Classification Level Classification E-value
Superfamily Flavoproteins 2.3e-58
Family Cytochrome p450 reductase N-terminal domain-like 0.0000000192
Further Details:      
 
Domain Number 4 Region: 1236-1399
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.83e-49
Family NADPH-cytochrome p450 reductase-like 0.000000174
Further Details:      
 
Domain Number 5 Region: 13-109
Classification Level Classification E-value
Superfamily PDZ domain-like 3.15e-22
Family PDZ domain 0.0000164
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000008430   Gene: ENSMLUG00000009207   Transcript: ENSMLUT00000009250
Sequence length 1433
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429948:2562544:2637083:1 gene:ENSMLUG00000009207 transcript:ENSMLUT00000009250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENHMFSVQQIQPNVISVRLFKRRVGGLGFLVKERVSKPPVIVSDLIRGGAAEQSGLIQA
GDIILAVNGQPLVDMSYASALEVLRGIASETHVVLILRGPEGFTTHLETTFTGDGTPKTI
RVTRPLGPPTTAVDLSHQSSACKEQPLAVDGATGPSNGPQHAQDNGPEAGSLSHTNGLDP
AKKNAGAARQCSEEHNELLKEIKPVLNLLTSADRGINGGGPTKAETKDAEVQVDRDLDAK
SHKPLPLGVENDRVFNDLWGKGNVPVVLNNPYSEKEQAPASGRQSPPKNGSPSKCPRFLK
VKNWETDVVLTDTLHLKSTLETGCSERICMGSVMQPSQQIRRPEDVRTKEQLFPLAKEFI
DQYYSSIKRFGSKAHMERLEEVNKEIETTSTYQLKDTELIYGAKHAWRNASRCVGRIQWS
KLQVFDARDCTTAHGMFNYICNHIKYATNKGNLRSAITIFPQRIDSKHDFRVWNSQLIRY
AGYKQPDGSILGDPANVEFTEICILQGWKPPRGRFDVLPLLLQANGNDPELFQIPPELVL
EVPIRHPKFEWFKDLGLKWYGLPAVSNMLLEIGGLEFSACPFSGWYMGTEIGVRDYCDNS
RYNILEEVAKKMNLDTRKTSSLWKDQALVEINIAVLYSFQSDKVTIVDHHSATESFIKHM
ENEYRCRGGCPADWVWIVPPMSGSITPVFHQEMLNYRLTPSFEYQVLPLPPDPWNTHLWK
GTNGTPTKRRAIGFKKLAEAVKFSAKLMGQAMAKRVKATILYGTETGKSQAYAKTLCEIF
KHAFDAKLFAMEDYDIVHLEHETLVLVVTSTFGNGDPPENGEKFGCALMEMRHPNSVQEE
RKSYKVRFNSVSSYSDFHKSSGNGPNHRDNFESTGPLANVRFSVFGLGSRAYPHFCAFGH
AVDTLLEELGGERILKMKEGDELCGQEEAFRTWAKKVFKTACDVFCVGDDVNIEKANNSL
ISNDRSWKRNKFRLTYVAEAPELTQGLSNVHKKRVSAARLLSRQNLQSPKSSRSTIFVRL
HTNGHQELQYQPGDHLGVFPGNQEDLVNALIERLEDAPPINQLVKVELLEERSTALGVIR
NWTDERRLPPCTIFQAFKYYLDITTPPTPLQLQQFASLATSEKEKQQLLVLSKGLQEYEE
WKWSKNPTIVEVLEEFQSVQMPATLLLTQLSLLQPRYYSISSSPDMYPEEVHLTVAIVSY
RTGDGEGPVHHGVCSSWLNQIQSDEVVPCFVRGAPGFHLPRNPQVPCILIGPGTGIAPFR
SFWQQRQFDIQHKGMSPCPMILVFGCRQSKVDHIYREETLQARSAGVFRELYTAYSREPD
RPKKYVQDILQEKLAEPLYQALKEQGGHIYVCGDVTMAADVLKAIQRIMAQQGKLSVEDA
GVFISRLRDDNRYHEDIFGVTLRTYEVTNRLRSESSIAFIEESKKDTDEVFSS
Download sequence
Identical sequences G1PDA1
ENSMLUP00000008430 ENSMLUP00000008430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]