SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000008440 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000008440
Domain Number 1 Region: 504-701
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.23e-50
Family SPRY domain 0.0033
Further Details:      
 
Domain Number 2 Region: 439-533
Classification Level Classification E-value
Superfamily Fibronectin type III 1.35e-17
Family Fibronectin type III 0.0019
Further Details:      
 
Domain Number 3 Region: 221-284
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000201
Family B-box zinc-binding domain 0.0018
Further Details:      
 
Domain Number 4 Region: 2-51
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000618
Family RING finger domain, C3HC4 0.014
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000008440
Domain Number - Region: 164-198
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0481
Family TFIIH p44 subunit cysteine-rich domain 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000008440   Gene: ENSMLUG00000009255   Transcript: ENSMLUT00000009261
Sequence length 710
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430071:554289:643948:1 gene:ENSMLUG00000009255 transcript:ENSMLUT00000009261 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEMEEELKCPVCGSFYREPIILPCSHNLCQACARNILVQTPESESPQSRRASGSGVSDY
DYLDLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPPATHLSPALAPV
PRNSCITCPQCHRSLILDDRGLRGFPKNRVLEGVIDRYQQSKAAALKCQLCEKAPKEATV
MCEQCDVFYCDPCRLRCHPPRGPLAKHRLVPPAQGRVSRRLSPRKVSTCTDHELENHSMY
CVQCKMPVCYQCLEEGKHSSHEVKALGAMWKLHKSQLSQALNGLSDRAKEAKEFLVQLRN
MVQQIQENSVEFEACLVAQCDALIDALNRRKAQLLARVNKEHEHKLKVVRDQISHCTVKL
RQTTGLMEYCLEVIKENDPSGFLQISDALIRRVHLTEDQWGKGTLTPRMTTDFDLSLDNS
PLLQSIHQLDFVQMKASSPVPATPILQLEECCTHNNSATLSWKQPPLSTVPAEGYILELD
DGNGGQFREVYVGKETMCTVDGLHFNSTYNARVKAFNKTGVSQYSKTLVLQTSEVAWFAF
DPGSAHSDIIFSNDNLTVTCSSYDDRVVLGKTGFSKGVHYWEITVDRYDNHPDPAFGVAR
IDVMKDVMLGKDDKAWAMYVDNNRSWFMHNNSHTNRTEGGIAKGATIGVLLDLNRKTLTF
FVNDEQQGPIAFENMEGLFFPAVSLNRNVQVTLHTGLPVPDFYSSRASIA
Download sequence
Identical sequences G1PDA7
ENSMLUP00000008440 ENSMLUP00000008440 XP_006100289.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]