SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000008442 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000008442
Domain Number 1 Region: 268-377
Classification Level Classification E-value
Superfamily PDZ domain-like 2.23e-26
Family PDZ domain 0.00000353
Further Details:      
 
Domain Number 2 Region: 135-240
Classification Level Classification E-value
Superfamily PDZ domain-like 1.97e-24
Family PDZ domain 0.0000483
Further Details:      
 
Domain Number 3 Region: 807-891
Classification Level Classification E-value
Superfamily PDZ domain-like 1.84e-16
Family PDZ domain 0.0000617
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000008442   Gene: ENSMLUG00000009262   Transcript: ENSMLUT00000009263
Sequence length 910
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430040:130007:191945:-1 gene:ENSMLUG00000009262 transcript:ENSMLUT00000009263 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNAQLDGLSVSSSSTGSLGSAARAGGGGHAGLRLLSGNVRQLHQALTALLSEAEREQFTH
CLNAYHARRNVFDLVSTLRVLLDSPVKRRLLPMLRLVIPRSDQLLFDQYTAEGLYLPATA
PYRQPAWGGPDGAGPGEVRLVSLRRAKAHEGLGFSIRGGSEHGVGIYVSLVEPGSLAEKE
GLKVGDQILRVNDKSLSRVTHAEAVKALKGSKKLVMSVYSAGRIPGGYVTNHIYTWVDPQ
GRSISPPASLPRPHSGALRPREGDRRSTLHLLQGGDEKKVNLVLGDGRSLGLTIRGGAEY
GLGIYVTGVDPGSEAESSGLKVGDQILEVNGRSFLNILHDEAVRLLKSSQHLILTVKDVG
RLPHARTTVDETKWIASSRIGDPATNSAGFPGDPTTEGADKLGFYKGPAGSQVTLSSLGN
QTRVLLEEQARHLLNEQERATMAYYLEEYRGGSVSVEALVMALFELLNTHAKFSLLSEVR
GTISPQDLDRFDHLVLRREIESMKARQPPGPGPGDTYSMVSYSDTGSSTGSHGTSTTVSS
ARERLLWLIDLMENTLDLEETGQAVQGNMNALPDVSLDEVKSTAEGLPGYKLPPPPPPLA
QPKKLGSQDQKPPSSASSHSGIVFSAPQNRSPPAGTAPAPEAPSAQDSPSSPIYASISPA
NPGAKRPLDAHLALVNQHPIGPFPRVQSPPHLRSPPAETTLAGGCLPPPSPSGRPDQTGT
NQHYVMVEVHRPDSEPDVNEVRALPQARTASTLSQLSDSGQTLSEDSGVDAGEVEASAPG
RGRQMASTKSRSSKDPPRNERSTEGATKPPGLLEPTSTLVRVKKSAATLGIAIEGGANTR
QPLPRIVTIQRGGSAHNCGQLKVGHVILEVNGLTLRGKEHREAARIIAEAFKTKECDYID
FLVTEFNVML
Download sequence
Identical sequences G1PDA9
ENSMLUP00000008442 XP_014320364.1.53796 ENSMLUP00000008442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]