SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000008454 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000008454
Domain Number 1 Region: 300-480
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.28e-41
Family DBL homology domain (DH-domain) 0.00034
Further Details:      
 
Domain Number 2 Region: 777-1009
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000000000238
Family WD40-repeat 0.025
Further Details:      
 
Domain Number 3 Region: 493-571,665-723
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000267
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000008454   Gene: ENSMLUG00000009248   Transcript: ENSMLUT00000009275
Sequence length 1243
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430290:133663:229843:-1 gene:ENSMLUG00000009248 transcript:ENSMLUT00000009275 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSSPPPQAATGDQLVPGGGLGPSPEAEDDPGEPFDFDDSDDDEDTSAGLGMPGVAPED
ADAPLIHLDAAPVTDPDPAASPPQTQVPAVVSNGDAVDTALSGVRRSSWKRKSSRRIDRF
TFPALDEDVIYDDVPCENLDARQPAGAERSLLYEDVRQDGAPREAEDLGWSSSEFESYSE
DSGEEAKPEAEPARHRVSFQPKMEQNSTSPSGGCKDELSSVAPAVCRPCCVTNLSDFPGD
SEDEDMGLLEVSVTDIKPPAPELGPMPDGLSPQQVVRRHTPGKGCVGVGAIQGSPVPGLQ
DYRNPLVEMEPKALSLRKCQVVFFRVKEILHCHSMFQIALSSRVAEWDASEKIGDLFVAS
FSKSMVLDVYSDYVNNFTNAMSIIKKACLTKPAFLEFLKRRQVCSPDRVTLYGLMVKPIQ
RFPQFILLLQDMLKNTPRGHPDRLSLQLALTELETLAEKLNEQKRLADQVAEIQQLTKSV
SDRSSLNKLLTSGQRQLLLCETLTETVYGDRGQLIKSKERRVFLLNDMLVCANINFKGQL
EISSLVPLGPKYVVKWNTALPQVQVVEVGQEGGSYDKDNVLIQHAGAKKSSASGQAQSKV
YFGPPRLFQELQDLQKDLAVVEQITLLISTLHGTYQNLNMTVAQDWCLALQRLMRVKEEE
IQSANKCRLRLLLPGKPDKSGRPISFMVVFITPNPLSKISWVNRLHLAKIGLREENQPGW
RCPDEDKKSKAPFWCPTLACCIPAFSSRGLSLQLGALVHSPVSSPLLGFSAVSTSLPQGY
LWVGGGQEGAGGQVEIFSLNRPSPRTVKSFPLAAPVLCMEYIPEPEEGENGDGDKDESHT
AADPSAAVHPTICLGLQDGSILIYSSVDTGTQCLATCRSPGLQPVLCLRHSPFHLFAGLQ
DGTLAAYPRTSGDVPWDLESPPVCLTVGPGPIRTLLSLEDAVWASCGPRVTVLDATSLQT
QQSFEAHQDEAVSVTHMVKAGSGVWMAFSSGSSIRLFHTETLEHLQEINIATRTTFLLPV
SGIRGKSHNLWAFPILSSSSVGVGRVRGSVTVTGAQSREGRASIIGQSLTCLSGRRGPET
VQPSGLKALAQDILRSDQRAEGPRAEEDKPDGQAPEPAPAPSSHVGRELTRKKGILLQYR
LRSTAHLPGPLLSVREPAPADGSALEHSEEDGSIYEMADDPDVWVRSRPCARDAHRKEIC
SVAIISGGQGYRNFGSASGVGGRPASCGDMDSTLLIWQVPLLT
Download sequence
Identical sequences G1PDC0
ENSMLUP00000008454 ENSMLUP00000008454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]