SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000008465 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000008465
Domain Number 1 Region: 592-878
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.43e-57
Family Protein kinases, catalytic subunit 0.0000105
Further Details:      
 
Domain Number 2 Region: 343-398
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000164
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000008465   Gene: ENSMLUG00000009278   Transcript: ENSMLUT00000009286
Sequence length 899
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429948:2262169:2466871:1 gene:ENSMLUG00000009278 transcript:ENSMLUT00000009286 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLQSKLVKYFSRQLSCKKKVALQERNAELDGFPQLRHWFRIVDVRKEVLEEITPGQLSLE
DLLEMTDEQVCETVEKYGANQEECARLNASLSCLRNVHISGGNLSKQDWTIQWPTTETGK
ENSPVCAPEPTPWIRTHLSQSPRVQSKCAQLYCHASPTPGAPVYTQVDRLTVDTYPGLCP
PPPLESGHRSLPPSPRQRHAVRTPPRTPNIVTTVTPPGTPPMRRKNKLKPPGTPPPSSRK
LIHLLPGFTALHRSKSHEFQLGHRVDEAHTPKAKKKSKPLNLKIHSSVGSCENIPAQQRS
PLLCERSLRSFFVGQGPFLPSTPPVHSEANFSSNTLSVPRWSQISRRDLSNSIKHRFSTK
YWMSQTCTVCGKGMLFGLKCKNCKLKCHNKCTKEAPPCHLLIIHRGDPARLVRTESVPCD
INNPLRKPPRYSDLHISQTLPKTNKINKHYSPCPFTPWSSSVNPGSRSPAFSKTVPPPLP
PSTSPSIFPFLSPSPLHPSPQCTRQQKTFNLPASHYYQYKQQFIFPDVVPVLETPTRAPQ
VVLHPVTSNPILEGNPLLQIEVEPTSENEEGHDEAEESEDDFEEMNLSLLSARSFPRKAS
QTSIFLQEWDIPFEQLEIGELIGKGRFGQVYHGRWHGEVAIRLIDIERDNEEQLKAFKRE
VMAYRQTRHENVVLFMGACMSPPHLAIITSLCKGRTLYSVVRDAKIVLDVNKTRQIAQEI
VKGMGYLHAKGILHKDLKSKNVFYDNGKVVITDFGLFSISGVLQAGRREDKLRIQNGWLC
HLAPEIIRQLSPDTEEDKLPFSKHSDVFALGTIWYELHAREWPFKTQPAEAIIWQMGTGM
KPNLSQIGVGKEISDILLFCWAFEQEERPTFTKLMDMLEKLPKRNRRLSHPGHFWKSAE
Download sequence
Identical sequences G1PDC8
ENSMLUP00000008465 ENSMLUP00000008465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]