SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000008517 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000008517
Domain Number 1 Region: 3-210
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.49e-60
Family BAR domain 0.00000818
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000008517   Gene: ENSMLUG00000009337   Transcript: ENSMLUT00000009343
Sequence length 438
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429785:7338804:7404912:1 gene:ENSMLUG00000009337 transcript:ENSMLUT00000009343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLQKLGKADETKDEQFEEYVQNFKRQEAEGTRLQRELRGYLAAIKAPGMQEASMKLTESL
HEVYEPDWYGREDVKTVGEKCDVLWEDFHQKLVDGSLLTLDTYLGQFPDIKNRIAKRSRK
LVDYDSARHHLEALQSSKRKDESRISKAEEEFQKAQKVFEEFNVDLQEELPSLWSRRVGF
YVNTFKNVSSLEAKFHKEIAVLCHKLYEVMTKLGDQHADKAFTIQGAPSDSGPLRIAKTP
SPPEEPSPLPSPTASPNHTLAPASPAPARPRSPSQTRKGPPVPPLPKVTPTKELQQENII
SFFEDNFVPEISVTTPSQNEVPEVKKEETLLDLDFDPFKPDVAPAGSAGVTHSPMSQTLP
WDLWTTSADLVQPASDGSFNGFTQPQDTSLFTMQTDQNIICNLAESEQAPPAEPKAEEPL
AAAPAEDTQAEEPEGAVV
Download sequence
Identical sequences G1PDH2
ENSMLUP00000008517 ENSMLUP00000008517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]